Top:/Emulation/Archives/Atari ST

link thumbnail Little Green Desktop - The Real Atari ST!, The cool

an excellent source for ST disk images
(Added 2003-11-12, 405 hits, more)
link thumbnail Atari ST Emulation par Mr Nours fr translate

(Added 2003-11-13, 482 hits, more)
link thumbnail Atari St Games fr translate

(Added 2003-11-13, 532 hits, more)
link thumbnail Automation and D-Bug
Archive of D-Bug Atari ST menu disks.
(Added 2007-10-21, 330 hits, more)
link thumbnail Forgotten classic now available on the Internet!

Download the unreleased ST version of Jet Set Willy here.
(Added 2006-07-17, 278 hits, more)
link thumbnail ftp://ftp.cs.tu-berlin.de/pub/atari/games/
collection of CDs at TU Berlin
(Added 2003-11-13, 520 hits, more)
link thumbnail ftp://kurobox.serveftp.net:3021/
Large Atari ST software archive.
(Added 2006-09-04, 574 hits, more)
link thumbnail Fuzion Shrine, The enfr

CDs by Fuzion for download
(Added 2003-11-13, 514 hits, more)
link thumbnail GamebaseST
Atari ST Emulator Frontend for Windows supporting Steem and SainT. Comes with a rather complete games database more than 1 GB in size!
(Added 2006-09-04, 456 hits, more)
link thumbnail Medway Boys Menus
Archive of the Atari ST 'compact disks' released by Medway Boys.
(Added 2006-09-05, 341 hits, more)
link thumbnail noid.atari.org enfr

small archive
(Added 2003-11-13, 297 hits, more)
link thumbnail PaCigame Area
collection of CDs from the less-well-known Atari ST groups
(Added 2003-11-13, 393 hits, more)
link thumbnail public ATARI de translate
Atari ST Public Domain software archive.
(Added 2006-09-02, 533 hits, more)
link thumbnail TiK's Atari ST image riot fr translate

(Added 2003-11-13, 428 hits, more)
Search:

Tags

playersremakenewsms-dosarchivepeoplefrontierascii artvideosaturngraphicsolafnesfrenchqlimagesfujitsuexcerptengineron gilbertsfccomputingconverterswiisidspectravideohuccompilationsvectrexoperating systemflyersarchivedhitchhiker8-bitneopocottsnkemulationddrmipscd-ipdftechnotesapple 1handycomputermanualgame gearxm7scott adamsbookreplicasik+petmastertronicgp2xpectrummapscommercialartworkshopintroductionpcwcompilerfan gamesmonkey islandsonykonamiid softwarehumorbard's talecommander keeninfoneskegscopy protectionmanualsgeocitiesmz-700c64biographycapcomharvestagiff7underdogstoolscartridgexboxatomatari 8-bitcreatorssonicrom hackingmagnetic scrollssnes9xbbc basiczopharpasopiaunmaintainedz-codepsxbasicnescolecovisiontoshiya takeda3doodyssey2eliteddjnamcondsnetworkingpaul robsonarcadiabluemsxcaanoosinclairgbcmupenfpsecompatibilitynecmagazinesrottspecstoolchainelectrononline playosxportcpuvaxhereticanalysisaltairguidedtvonlineromsti-92epsondownloadscps2javametal geargiana sistersopen sourcewolfenstein 3dtoshibaboulder dashemulatorpom1pc98rick dangerousbenj edwardscharles macdonaldpc enginesoftwaretimelinewalkthroughsmz-80068kguideslinuxifremixesbasicnesduke nukemsimcoupeusstellanvgtrs-80screenshotsfaqsgbangpquasi88nsfindiana jonesgifmagazinemessx68000gp2xlibrarygallerymp3usenetpc-fxdescent65816apple 2midihandheldsgbtoolpocketpctvpcsxfpcegamebasei18nfm-7mega drivesdkatariarchimedesedgexgsdemo scenesovietwonderswanrichard bannisterpinoutszorkllamasoftabandonwarecoversmaemotrailblazermaniac mansionbeebfrodo3d realmsfdsvcshintssquaresoftfan artfolkloremediapokesnestermerchandisespainapplemz-80wikirainbowgradiusmailing listpc-88windowsoric6502forumatari ststrategyreferencesoundngcdpentagonwinampneopoppirateshistoryvideo gamespreservationflashcartslynxcolumnsboycott advancecensorshipmac osconverterclonesti-99/4adma designultimastorybo zimmermaninterviewshprpgsrzxspace invadershugues johnsonauctionsgermanycopiersadskigbhomepagejapandatasheetsfranceretrodevfpganeo4allcasiosg-1000hi-scoresgamecubex86powerpcsega cdvbatriviareviewsabc80streaminggenesis pluscommodoreemulatorsfreebsddemoscreativisiondumpingfamtasiavgbpv-1000ukcollectingformatscheatssharewarecodefinal fantasymagickitassemblersms pluszaurusconsolesapple 2gsitos/2acornscorpionsymbianchronologykim-1cgp32martin korthtgemujapanesegame designinfocomthalionsnatchermulewinuaeideflashscansquotesto8adventure gamescamputers lynxprogrammingsierraatari800multifacegizmondoscummfmsxsmsphilipsjrpgsssemcomposersbeosx1fm townsn64macsunosibmapogeemsxschematicsmarat fayzullindarcnesqnxfceresourcesmodsteodownloadcartridgesarnolddreamcastfan fictionluxorwscdnapointlessspritesaction replayamstradz80tutorialatari 5200mac plusatari 7800arstechnicadavid foxcastawayunreleasedmega mancomputersblogsc-3000clubstudio 2atari stedocszx spectrumxzxmaking ofyoutubeshmupgplasciiartralph baercollectiongamemo5dosboxgithubpandorawikipediauae4allmasteropenglincompleterpgdatabaseradiocharactersnet yarozepodcastfirmwaregame boytnkcompressionpsionfellowshmupsc128ebaysoundtrackshead over heelsmoviesscummvmadventure gamebookspatchesastrocadethomzx80chip8gnuboysmartphoneseriesdelphixm6aquariusc16recompilerversionssupervisionmastergearacademicunixvic-20armjum52adamcatalogendingsgremlinvirtual boymtxspace questgrim fandangolittle johngamesdragonfanzinedemovideosrom hacksfusepc-6000pc-98newslettertandyhexensharppublisherjupiter acewizpluginrisc osdiskmagstutorials.netsource codejaguarcivilizationdingoomarcel de kogelsf-7000aixtranslationsfinal burnfaqbabypalmosjumpmanbbcmameinterviewftpiaremakeslisadebuggerpsfj2mejswarcadenintendoitalycpcrom hackmike daillycomicsdoomuaetype-insolutionsgamasutrabox shotssolarislinkslost sourceamiga32xvicegeneratorarticlescocorom listingsti-89encyclopediato7p2000smallzx81bugslucasartsibm pcneo geosegacp/mjeff minterconversioncalculatormuseumintellivisiontcp/iptosngpcpasswordsculturenewslettersjrpggccwindows cemo6osf/1androidbiosinterpreterinstallersscimusictaitocompetitiondottinterpretersfeaturepspsam coupĂ©hardwareiosgermanplus/4articleps2sdlwalkthroughcd32visual basicphotoscolemmark3