Top:/Emulation/Emulators/PlayStation

1 2 >   Next Page >>
link thumbnail PCSX cool hot
Open-source PlayStation emulator for Linux and Windows.
[Source and binary downloads have been archived. Never thought I'd see this go off the air once...]
(Added 2003-11-12, 2240 hits, more)
link thumbnail pSX emulator cool
Monolithic PlayStation emulator for Windows and Linux/x86.
This emulator fully emulates the Sony Playstation. Compatibility is fairly high, most games I've tried work well.

An R3000 debugger is contained which may be of interest to people working on translations.
[Downloads have been archived.]
(Added 2006-07-06, 485 hits, more)
link thumbnail PCSX2 hot
PlayStation 2 emulator for Windows and Linux.
(Added 2003-12-16, 5731 hits, more)
link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1078 hits, more)
link thumbnail ePSXe
PlayStation emulator for Linux/x86, Windows, and Android.
(Added 2003-11-12, 441 hits, more)
link thumbnail FlareStorm ja translate
PSX emulator for Mac OS X.
(Added 2006-02-24, 545 hits, more)
link thumbnail FPSE
PlayStation emulator available on a number of platforms.
[Downloads have only been archived partially.]
(Added 2006-02-24, 532 hits, more)
link thumbnail FPSE AmigaPPC
Amiga/PPC port of PSX emulator FPSE.
(Added 2008-03-19, 284 hits, more)
link thumbnail FPSEce
PocketPC and Android port of PlayStation emulator FPSE.
(Added 2008-03-26, 383 hits, more)
link thumbnail no$psx
PlayStation emulator for Windows by Martin Korth.
The Emulation should be complete with all hardware features fully implemented and working, though as by now it wasn't tested with too many games, so there may be still some problems with other games (bug reports are welcome).
(Added 2013-01-06, 215 hits, more)
link thumbnail pcsx-df
PCSX-df is a fork of the PCSX Playstation emulator designed specifically for GNU/Linux (and probably other similar systems). It has a completely reworked and modernized GTK2/Glade GUI, integrated plugins, an improved system for classic PSEmu plugins, better configuration tools, support for translation, easy installation, and support for AMD64.
(Added 2014-02-22, 381 hits, more)
link thumbnail PCSX-Reloaded
PCSX-Reloaded is a PlayStation Emulator based on PCSX-df 1.9, with support for Windows, GNU/Linux and Mac OS X as well as many bugfixes and improvements.

Note: This project is affiliated with neither PCSX nor PCSX-df project and should be considered as an separate derived work, so please don't confuse this project with the original PCSX or bother the original PCSX developers ...
(Added 2014-02-22, 433 hits, more)
link thumbnail PK201 ja translate
Sony PocketStation technical documentation and emulator for Windows.
(Added 2008-06-15, 309 hits, more)
link thumbnail PSP Player
Unmaintained and incomplete open-source PSP emulator written in C#.
(Added 2008-03-26, 262 hits, more)
link thumbnail psx4all (GitHub)
PlayStation emulator for various handheld devices.
(Added 2012-10-08, 1673 hits, more)
1 2 >   Next Page >>
Search:

Tags

guidebiosbasicnesjapancharles macdonaldartworkspace questformatsfrontieragiprogrammingwikipediaremakeff7apple 2fanzinefreebsdidesupervisionz-codemartin korthhereticzx81incompleteplus/4biographyfan gamescomputingxgsversionsarticle65816box shotsnecrick dangerousstella3d realmsto8maniac mansionluxori18narchivebeebcomposersreplicassdkdemo scenerom hackskonamicolecovisionwonderswannewsgccvisual basicscott adamsdumpingscummvmresourcescp/mpocketpcseriesthomsg-1000chronologytvpc98nestercps2video gamestoshibacompilersonyphotosrom hackingpointlesstutorialssdlmac os6502tcp/ipsoftwarefolkloregallerycomputersmartphoneinterpretersnsfopenglpaul robsonpsxpc-88kegsfaqpsiontranslationssaturntriviadiskmagsatari 8-bitmastergearbbcmusicwizemulationclonesdott3dofaqsgradiusngpcsmalltandylinuxos/2preservationgp2xpectrumgithubandroidcpuhistorytnkwalkthroughcataloglynxremakestechnotesboulder dashamstradmark3ndsfinal burncodeddjdragonhi-scoresyoutubemarcel de kogelflyersxm7sonicpom1pentagonfamtasiatutorialpeopledreamcastcaanooauctionscompressionbabyfusehandyexcerptatari stejum52civilizationsharpmega manftpbo zimmermannamcomediallamasofttosrecompilerepsoncolemgermanysmsreviewshandheldmagickitscorpionmameinterpreternewslettersdebuggercreatorsrisc osemulatoraquariusgbcvic-2032xmagazineswindows cejavaretrodevinterviewmp3descentkim-1zopharplayersdelphidatabasemagazinemetal gearlibraryunixmoviessolarisadamcompetitionabandonwareblogsnes9xwolfenstein 3dzx80little johnvgbarmrpgsdtvfm-7pokestimelinebbc basiccommercialpc-6000toshiya takedamerchandisevirtual boyvbaspainataribenj edwardslinkspublishertgemuhugues johnsonfmsxapogeeaction replayshmupcompatibilityfellowmaemotrailblazeriaflashvideosms-dossfcendingsrottukfan artmagnetic scrolls68kmega drivewsccomicsti-99/4aanalysisj2meunreleasedtaitoarchimedesmasterxzxxm6pluginspace invaderscharactersdma designarcadiafdssega cdremixesgame designuaevaxtoolchainik+applemastertronicsymbianqnxdosboxfrenchneo geovcscocogp2xstudio 2apple 1indiana jonesssemcapcominfonesrzxpv-1000passwordsmuseum8-bitspectravideoconverterimagescartridgeculturejrpgsmuleshopencyclopediawikiteospecsatari 7800windowsemulatorsrichard bannisterc16modsmapsenginehitchhikerneopopinfocomconsolessinclairacademicmac plusportuae4alladventure gamesdoomsharewarethalionwalkthroughslisaatomdingoonvgzaurusmarat fayzullinoperating systemzorkgrim fandangohppc engineinstallersgnuboysgbdarcnesmidicheatsbluemsxsoundtracksjapaneseultimadnasunosassemblerngcdhumorsnknewslettermo5philipselectronintellivisionfrodoadventure gamehuccasiotype-inatari stusdatasheetsid softwarenesmo6piratesfpgavicegp32generatoracornapple 2gsqlbugsx1creativisionjaguarfirmwareddratari 5200pasopiahomepageconversionharvestsms plusgamecubepinoutscensorshiprainbowsovietchip8clubarstechnicaromstoolsjswngpcartridgesgamebasestrategykigbpandoraforumhexendavid foxmanualgremlinonline playpc-fxti-92genesis plusonline.netsierraedgefpcereferencegamesmz-80adsgpldownloadhead over heelscollectinggeocitiesintroductionlost sourcebasichintsfrancegamejeff minterhardwarepcsxpatchesquotesflashcartsmonkey islandibm pcvideomailing listdocsfan fictiongbascansstorycastawayarcadezx spectrummike daillyc64simcoupearchivedabc80arnoldmipsradiopc-98gizmondographicsz80nintendogiffm townscolumnsitatari800unmaintainedralph baerneopocottunderdogsgame gearsidpspto7ascii artastrocadepalmoscalculatormupencpctrs-80beosbookmacolafnescommodoremz-700ifpetjrpgrom hacksc-3000scitoolfinal fantasypowerpcioswinampdemosconverterslucasartsquasi88segagame boywinuaecd32x68000ron gilbertcompilationsp2000asciiartc128usenetsoundmtxmz-800vectrexsource codeoricmanualsschematicsccamputers lynxosxaixpcwaltairsquaresoftx86ibmduke nukemamigagiana sisterswiifpsexboxps2scummitalyinterviewsmesssnatcherfeatureneo4allopen sourcepdfosf/1streamingnetworkingcopy protectionarticlesfcecollectionsf-7000fujitsurom listingsbard's talesolutionsodyssey2germancoversspritesbooksdemoscreenshotsgamasutrapsfshmupsrpgnet yarozepodcastguidescopierscomputersmsxboycott advancejupiter acejumpmancommander keendownloadsn64sam coupĂ©making ofti-89cd-iebayelitemultiface