Top:/Emulation/Emulators/PC Engine

link thumbnail Hu-Go cool enfr
PC Engine emulator derived from FPCE, and available for Linux, Windows, DOS, BeOS, Morphos, and Solaris.
(Added 2003-11-12, 865 hits, more)
link thumbnail Ootake cool enja
PC Engine emulator for Windows, probably the best currently available.
(Added 2006-10-08, 573 hits, more)
link thumbnail Acorn HuGo Homepage
This is a port of one of the best PC Engine emulators out there. It runs most things you can throw at it. Unfortunately this Acorn version is way begind the Winodws release. I'll bring it into sync once I have sorted out a few issues with CD emulation, that have been giving me trouble.
(Added 2012-10-08, 294 hits, more)
link thumbnail FPCE
Unmaintained and incomplete PC Engine emulator for DOS and PlayStation.
This software is at a *VERY* early stage. It currently only works with few carts. If you wish to play games,there are other decent emulators available. If you are interested in how this emulator was written, you may find my source code useful (Although it's very dirty code.) The source is for PC-AT/VGA and PC-9801 ...
(Added 2007-11-13, 316 hits, more)
link thumbnail GPengine
Full-speed PC Engine emulator for GP32.
(Added 2007-11-13, 317 hits, more)
link thumbnail Magic Engine enfr
Shareware PC Engine emulator for Windows and Mac OS.
(Added 2003-11-12, 287 hits, more)
link thumbnail RiscPCE
PC Engine emulator for RiscOS.
Sound is fully emulated and on a StrongARM the speed is typically well in excess of the magic 60 fps, so it's possible a multi-tasking version may appear later on. It is still very much a work in progress [...]
(Added 2007-11-19, 226 hits, more)
link thumbnail SquidgeNgine
PC Engine emulator for GP2X without sound support.
(Added 2007-06-12, 537 hits, more)
link thumbnail TGEmu
PC Engine emulator for DOS and Windows.
(Added 2007-11-23, 253 hits, more)
link thumbnail TGEmu for Mac OS
Mac OS port of PC Engine emulator TGEmu. No source code provided.
(Added 2006-08-31, 438 hits, more)
link thumbnail Turbo Engine 16 (AamirM's Home Page)
Turbo Engine is an accuracy focused emulator which can emulate the following NEC console systems with very high degree of accuracy:
  • PC Engine / TurboGrafx-16
  • SuperGrafx
  • CDROM² / SuperCDROM²
Due the way Turbo Engine emulates the hardware, the system requirements to run games fullspeed are a bit high. This issue is being addressed by optimiz ...
(Added 2012-10-08, 107 hits, more)
link thumbnail VPCE
PC Engine emulator for DOS.
[Downloads have not been archived; the DOS binary can be found at Zophar's Domain.]
(Added 2013-01-24, 555 hits, more)
link thumbnail VPCE/RiscOS
RISC OS port of Virtual PC Engine.
It requires a VIDC20 (RISC PC and A7000) because it uses a definable 256 colour palette, but it's only playable on a StrongARM anyway. The speed, on a StrongARM, varies between about 15-37 fps but the average speed is currently around 24 fps (a real PC Engine runs at around 60 fps).
(Added 2008-04-22, 189 hits, more)
link thumbnail XPCE enja
FPCE-based PC Engine emulator for Windows.
(Added 2007-11-23, 285 hits, more)
Search:

Tags

x86midimega manopen sourceoperating systemcfrodometal gearsega cdshmupmsxunreleasedgizmondocompilernecdebuggerhintsvbahumorms-dos3doabandonwaredocshereticdottpetmipscompressionoricepsonsgbarchivedpcsxsharptoshiya takedapocketpcmodsgp2xpectrumron gilbertmapsmastertronicbbcsource codebeosblogxm6neopopgremlinpublisherj2mepointlessdreamcastdemoscommander keenpatchesmac oshandy.netkegsaltairbiosatari stpokesjavafellowvaxpeoplepodcastpandoratoshibasf-7000computerrpgdarcneswindowsnamcoandroidqlsonybasicnesaction replaycps2fan fictionemulatorvic-20sam coupéaquariusdosboxconsolesfujitsuimagesscixgsapple 2head over heelstriviaconversionflashenginecharles macdonaldtgemusovietdiskmagscartridgeslynxtvngpcwscz80agismssolutionsnet yarozemagickitreferencechip8zx80moviesacorntutorialgame designmega drivepc-fxdownloadflashcartspv-1000catalogjeff mintergallerypsxbeebtoolscompatibilityosxstreamingguidesportcompilationsmz-80emulatorsadventure gameapple 1technotesmultifacebard's talearticlesgccfpsecolecovisiondingootranslationsrom listingsrisc osngcdmo6rom hacksneo geocomputerspirateshi-scoresndsemulationseriesvideosps2underdogspc enginecollectionddrscummsegacpugifhitchhikerarcadecodemupentimelineonlinerom hackingplus/4llamasoftamigaradioneopocottsidstoryrecompilersc-3000tandypsiontosvisual basicgame boyamstradgenesis plusadventure gamesmessthalionibmti-99/4acharactersapple 2gsnvgultimateotrs-80mulepalmosjupiter acedtvralph baeredgetype-inaixsymbianosf/1nintendoromsneo4allzx spectrummarcel de kogelhuchomepagegeocitiesmark3pasopiasinclairapplequasi88adspc-98interviewgplatari 5200n64introductionjum52zauruspaul robsonmagazinegradiusssemtcp/iphugues johnsonmerchandisesoundmasterincompletefirmwaresdkgraphicslittle johnprogrammingdatasheetsfan art3d realmswizmaking ofscreenshotsadampdffinal fantasyarcadiamarat fayzullinendingspreservationcasiodemotrailblazermonkey islanddma designddjabc80columnssmallnewslettersplayerseliterainbowatariinfonesfm townsngpjapan68klisansfastrocadethommike daillyboycott advancepowerpcmusicstudio 2cheatsdownloadsgp32quotesmaemomtxcopy protectiontnk65816usenet32xxzxodyssey2gamegamasutrarzxbox shotsopenglascii artbo zimmermansmartphoneshophandheldculturetoolrick dangeroussierraguideintellivisionindiana joneszopharto8manualscamputers lynxmuseumwinuaejaguarsnes9xfolkloregeneratorxboxcompetitiondnamacresourcescreativisiongbcgermanymameatomsquaresoftcartridgeschematicsscanswikipediadescentcopierscensorshipvcshardwaresfcuae4allcaanoosimcoupeforumcocoqnxmailing listwiiarticlepom1linkscoverswalkthroughsgameszorkxm7databaseonline playspectravideoharvestiagrim fandangoluxoratari 7800interpreterinstallers6502martin korthrpgssoundtrackssms plusarnoldremakesclubnesnetworkingmp3githubformatskigbfcedoomfan gamesmagazinespinoutscollectingapogeeartworkcolemduke nukemphotosjrpgsstrategycomputinginterviewsflyersspace questc128tutorialsitmac plussolarisos/2sonicgermanspaincomicsbenj edwardsto7remixesff7italycapcomfinal burnid softwareinfocomti-89hexeniflinuxsdlelectronrichard bannisterp2000chronologyspace invadersnewslettergnuboyfanzinecomposersfpgagbadumpingwikikonamidemo scenebookassemblerarchivedelphipspsaturnnewsgiana sistersolafnescastawaynestersharewarefrontierfaqgp2xsoftwareyoutuberemakeshmupscpctoolchainfm-7x1fmsxrom hackpc-6000civilizationbbc basicunixti-92convertersmz-800wonderswanbooksretrodevpentagoncd-icd32videospritesukboulder dashanalysisvgbsupervisionusrottcp/mcommodoreauctionszx81z-codeatari steatari800video gamesmo5faqsi18nmediasunoscalculatoribm pcwinampgame gearfeaturecommercialc64bugsarchimedesspecspc98maniac mansionconverterarmfamtasiapsfc16ebayatari 8-bitwalkthroughreplicasfpceinterpretersik+fusejumpmanwindows ceacademicbluemsxphilipsftptaitohpscott adamsbiography8-bitpc-88vicevirtual boyscorpionpcwuaeideunmaintainedversionsdavid foxencyclopediavectrexasciiartmanualbasicarstechnicasnkgamecubejapanesegamebasepluginpasswordssg-1000lucasartsfreebsdlibraryfdsjswfranceclonessnatchercreatorsexcerptreviewsbabydragonmz-700jrpgiosscummvmx68000historykim-1wolfenstein 3dmagnetic scrollsmastergearstellafrenchlost source