Top:/Vintage Systems/Acorn

Emulators@
Software archives@
1 2 >   Next Page >>
link thumbnail Acorn Rocketship, The cool enja
The famous RiscPC with kitchen sink and pizza oven.
(Added 2003-11-12, 716 hits, more)
link thumbnail About Acorn computers and ARM processors
History, hardware, prototypes, software, operating system, screenshots, and more.
(Added 2003-11-12, 719 hits, more)
link thumbnail Acorn 6502 Microcomputer Kit
About Acorn Computers' first public offering, the Acorn Microcomputer, later known as the Acorn System 1.
(Added 2007-09-09, 550 hits, more)
link thumbnail Acorn Atom pre-history, The
Details and photographs of the industrial and educational systems Acorn produced, before turning to the consumer-orientated market.
(Added 2007-11-08, 500 hits, more)
link thumbnail Acorn Atom Projects

Includes details of a DRAM interface, routines for triangle filling, horizontal line drawing, and ROM reading, a memory map diagram, and a parts list.
(Added 2007-11-08, 505 hits, more)
link thumbnail Acorn Atom Review, The ennl

Detailed information about the Atom, along with photographs, diagrams, and manuals to download.
(Added 2007-11-08, 492 hits, more)
link thumbnail Acorn computer user WWW Server, The
Archimedes-related product info, documents, and technical information.
(Added 2007-11-08, 651 hits, more)
link thumbnail Acorn Electron Lives!
Dedicated to the Acorn Electron. Specs, expansions, hardware projects, game downloads, magazine covers.
(Added 2006-08-17, 874 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 711 hits, more)
link thumbnail Acorn Technical Documents Archive
Archimedes-related technical documents, including many early ones, with a focus on hardware.
(Added 2007-11-08, 678 hits, more)
link thumbnail ARM7 second processor (Sprow's Webpages)
During the development of the original ARM microprocessor, the ARM1, a test system was created called The ARM Evaluation System which ran an enhanced version of BASIC with up to 4Mbyte of RAM. This allowed the developers to try out the new core without needing to design an entire computer, though as it wasn't sold as a commercial system very few were ever built.
[...]
The ...
(Added 2012-10-08, 486 hits, more)
link thumbnail Arthur lives!
Dedicated to Arthur, the Acorn Archimedes' original operating system. ROM image available.
(Added 2007-09-10, 686 hits, more)
link thumbnail BBC Documentation Project
Collects documentation of all sorts on the BBC Micro.
(Added 2003-11-12, 585 hits, more)
link thumbnail BBC Emulation and File Transfer

Information on and programs for transferring files between a PC and a BBC.
(Added 2007-11-08, 532 hits, more)
link thumbnail BBC lives!, The
The net's largest site catering for enthusiasts of Acorn's range of 8-bit micros from the eighties: the BBC models, Electron, Master and Compact, and to a small degree the Atom and Archimedes.
(Added 2007-09-12, 616 hits, more)
1 2 >   Next Page >>
Search:

Tags

studio 2tutorialinfonesnet yarozeartworkaquariusjum52demosms-dosfm townsvbaitalyinfocomsf-7000frodogeneratorneopocottcompilersmsemulatorswalkthroughsff7screenshotsvideo gamessoundtracksascii artneo geovic-20amigaversionstaitonewsletteronlinegermanysega cdnintendosc-3000psxwinuae3d realmsdarcnesrom hackgamecubeto8collectingunderdogsqlngcdosxschematicsarchivedstorycd32auctionszx81xm6fujitsuformatsmega mansquaresofthomepagediskmagshandymanualfellowgp32tvanalysisfrenchrichard bannisterhitchhikerfanzinemagickitlinkspandoracommercialgremlinchronologypowerpcstellasymbianpc-600032xatari 8-bitadampodcastendingsnewsletterscopy protectionreviewsjumpmanremixesdottcomicsreferencexm7pluginfan fictionmz-800pocketpcgraphicsjavaosf/1wolfenstein 3dbasicfinal burnzaurustnkgp2xpectrumcopiers6502lost sourcemega drivepc-98bbcphotosrisc osmarcel de kogelcocomac plusaction replaydemo scenemanualssnatchercolumnsz80soundscott adamsdatabasemediaarticlessimcoupelinuxfmsxwindows cewikipediamtxfdspom1macdownloadcivilizationapogeeyoutubereplicastoolsexcerptclubmailing listphilipsrainbowmoviescaanoocomposersscummvmx68000lisaclonesgradiusid softwareradiogallerypcwgiana sistersfpgacheatsron gilbertsam coupĂ©catarisource codeguidesgizmondokim-1gamasutrainterviewmupen8-bitatari stidezorkshmupsaltairneopoptosflyershugues johnsoncompatibilitycodedownloadsspainfrancetoolchainiasharpabc80debuggerspace invadersboycott advancekigbsnkindiana jonesfan gamestechnotesmidigame designsdkastrocademac osluxoredgedragongame gearchip8magnetic scrollscd-ielitecomputingapple 1atari stegrim fandangosunosmike daillyrom hackingj2mex1musicstrategyappleneo4allrpgsralph baerpc-fxwikingpcartridgesfaqarcadiadma designscummnesterconversionsaturnllamasoftconverterwinamprick dangerousspritesdreamcastarstechnicadosboxpokesitsfccompilationspv-1000delphitrailblazerpsfti-92zx80genesis plusmastergearadventure gamesopenglfpsexzxstreamingincompleteseriescatalogculturebluemsxcharles macdonaldlittle johnvgbfaqsifjrpgsvcsgifcpcsonicoperating systempetmagazineoricgbac128kegssg-1000museumhi-scoresdescentcensorshiparmpcsxdingooz-codebox shotsdemoolafnesfeatureresourcespdfvicethomcp/mcastawayinterpretercoversmaking ofjrpghpepsonsnes9xspace questatari800colemik+emulationvideobenj edwardssupervisionultimaapple 2gsfpceplus/4ddjjapanmaniac mansionfuserzxioshandheldcreatorsti-89archimedesdoomgccmipsmetal gearqnxunreleasedcompetitionemulatorcollectionscorpionpspvisual basicukfm-7lynxmaemointerviewsfrontierdumpinginstallersbiographysdlmonkey islandlibraryhead over heelsaixsolutionsfcewiiadventure gametcp/ipos/2mp3specsbookibmpasswordssinclairjswti-99/4aneccolecovisionatari 7800martin korthodyssey2rom listingsarcademark3datasheetsboulder dashshop.netbabyforumcreativisionhexencalculatorjeff minterteoebayretrodevbard's taleadsuae4allwizremakesvaxunixandroidcommodoreharvestmsxsmartphonecommander keentoshiya takedanvginterpretersatombooksi18nsgbscisonyftptutorialscomputersc64gnuboy65816bugsto7solarisbbc basicjupiter acendstype-incapcomacademicportgithubgame boydocsduke nukemamstradwalkthroughtranslationsjapanesepeoplemastertronicwindowsgermangamesassemblerfamtasiacamputers lynxcasiosegavirtual boybasicnesuaeapple 2rpgflashcartsencyclopediapaul robsonarticleagihistory3donewsgeocitiesmodssharewaretgemugamerom hacksusenetdavid foxmasterngpc68kps2pentagonsoftwaregp2xfolklorec16videosenginexgspc98pasopiafirmwarefan artcpuabandonwareelectronpatchesmagazinesmz-80jaguartandyx86wonderswanpc-88bo zimmermandtvmessopen sourcetriviaromsscanscomputermulelucasartshereticintroductiontimelinearchivep2000xboxquotespalmosgplatari 5200marat fayzullinasciiarthardwarednanetworkingkonamitrs-80toshibagamebasepc enginemo5thalionmamesidhintsprogrammingconvertersmapsfinal fantasyzx spectrumbioszopharibm pcguidebeebconsolesunmaintainednsfhucshmupplayersintellivisioncartridgepointlessmz-700sms plusflashcompressionmultifacen64smallcharacterssovietmo6merchandisewscnamcoacornfreebsdquasi88publisherusvectreximagesarnoldpinoutsssempiratesgbcpsioncps2sierrablogrottremaketoolbeosnesonline playddrpreservationspectravideohumorrecompiler