Top:/Vintage Systems/Acorn

Emulators@
Software archives@
1 2 >   Next Page >>
link thumbnail Acorn Rocketship, The cool enja
The famous RiscPC with kitchen sink and pizza oven.
(Added 2003-11-12, 702 hits, more)
link thumbnail About Acorn computers and ARM processors
History, hardware, prototypes, software, operating system, screenshots, and more.
(Added 2003-11-12, 700 hits, more)
link thumbnail Acorn 6502 Microcomputer Kit
About Acorn Computers' first public offering, the Acorn Microcomputer, later known as the Acorn System 1.
(Added 2007-09-09, 533 hits, more)
link thumbnail Acorn Atom pre-history, The
Details and photographs of the industrial and educational systems Acorn produced, before turning to the consumer-orientated market.
(Added 2007-11-08, 482 hits, more)
link thumbnail Acorn Atom Projects

Includes details of a DRAM interface, routines for triangle filling, horizontal line drawing, and ROM reading, a memory map diagram, and a parts list.
(Added 2007-11-08, 492 hits, more)
link thumbnail Acorn Atom Review, The ennl

Detailed information about the Atom, along with photographs, diagrams, and manuals to download.
(Added 2007-11-08, 478 hits, more)
link thumbnail Acorn computer user WWW Server, The
Archimedes-related product info, documents, and technical information.
(Added 2007-11-08, 637 hits, more)
link thumbnail Acorn Electron Lives!
Dedicated to the Acorn Electron. Specs, expansions, hardware projects, game downloads, magazine covers.
(Added 2006-08-17, 854 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 696 hits, more)
link thumbnail Acorn Technical Documents Archive
Archimedes-related technical documents, including many early ones, with a focus on hardware.
(Added 2007-11-08, 662 hits, more)
link thumbnail ARM7 second processor (Sprow's Webpages)
During the development of the original ARM microprocessor, the ARM1, a test system was created called The ARM Evaluation System which ran an enhanced version of BASIC with up to 4Mbyte of RAM. This allowed the developers to try out the new core without needing to design an entire computer, though as it wasn't sold as a commercial system very few were ever built.
[...]
The ...
(Added 2012-10-08, 471 hits, more)
link thumbnail Arthur lives!
Dedicated to Arthur, the Acorn Archimedes' original operating system. ROM image available.
(Added 2007-09-10, 668 hits, more)
link thumbnail BBC Documentation Project
Collects documentation of all sorts on the BBC Micro.
(Added 2003-11-12, 568 hits, more)
link thumbnail BBC Emulation and File Transfer

Information on and programs for transferring files between a PC and a BBC.
(Added 2007-11-08, 519 hits, more)
link thumbnail BBC lives!, The
The net's largest site catering for enthusiasts of Acorn's range of 8-bit micros from the eighties: the BBC models, Electron, Master and Compact, and to a small degree the Atom and Archimedes.
(Added 2007-09-12, 601 hits, more)
1 2 >   Next Page >>
Search:

Tags

iosbookfpcepalmosssemcasiogiana sistersabandonwareengineelectroncharactersgame designqnxxboxxzxjum52atari stereviewsmuleastrocadebeosdiskmagsnewsletterneopocottlinuxadventure gamessgbacornfanzinems-dosendingsopen sourceusenetneo geoportdatabasemetal gearinterviewscp/mpiratessymbiangp32pcsxvbamega drivefirmwareodyssey2peopleguidessf-7000c16x86videocolecovisiongrim fandangovideo gameszauruscomputingcompatibilityvisual basicpc98specssoviethumorjapangamebaseforummarat fayzullinfan gameskim-1monkey islandcreativisionpc-98sg-1000gbawscfan fictionbabymagazinesbo zimmermanonlinerom hacksarticlesuae4allamstradasciiartgallerymailing listitalycode.netsfcspace questpocketpctrailblazerrpgftp3d realmsarchimedesgnuboycivilizationhomepagecartridgesaturnintellivisionlibrarymp3docshpstellaarstechnicaid softwaregamecubepublisherfamtasiacolumnssoftwaresdkfdsjupiter acefinal burnwalkthroughsllamasoftmultifacedarcnesunderdogsunreleasedadventure gamethalionmanualrichard bannistertoolchainidefrodokigbti-896502handyvectrexboulder dashcharles macdonaldz80gremlinoperating systemstoryxm7dottmaemoimageszorkarcadedatasheetscoversneopopngpcneo4allbookspv-1000atari800calculatorbbcmartin korthlinkspandoracompressionspriteshuc65816mac plusrick dangerousdingoohi-scoresgradiussolarisversionssoundaixarnoldemulatorsn64shmupngpcomposersindiana jonesflashcartssharewaredemohistoryinfonessonygame gearunixibm pcfaqscompetitionscummvmspace invadersboycott advancexm6sega cdpsfapple 2gsguide68kmupenbugsron gilbertdebuggercommercialfellowsupervisionsnatcherepsonpc enginehitchhikersmallosf/1remakehugues johnsonsms plusshopcps2msxmaniac mansionflyersitgamesschematicsreplicasromsartworksdlcpuusgizmondodavid foxpatchesddjmuseumpentagonreferencemega manwizassemblersource codemz-800mac osfcecocoseriesamigagifemulatormameblogadamoricyoutubep2000apogeeprogrammingtosmark3featuremagazineopenglfpsecartridgescompilerpointlessatomonline playcomputersphilipsmipsremixessolutionsto8adsmtxdnafolkloremz-700virtual boymagickitmodsmesscatalogmapspdfhandheldapplesnkspectravideobbc basictranslationscommodorebluemsxflasharchivedumpinghardwareconverterinstallersjrpgsarcadiasharpedgetoshibasc-3000harvestcollectionmidipc-88clubx68000tutorialjumpmanduke nukemradiosoundtracksanalysiszx80playerslittle johngenesis plusz-code3dovaxpspscummcamputers lynxtcp/ip8-bitconvertershintsclonesplus/4pom1commander keenti-92abc80excerptpodcastcd-imike daillyfm-7infocomultimagccbiographysierracopiersscorpionpsionaquariusmarcel de kogelfan artgeneratorscansintroductionti-99/4awalkthroughfm townslynxmo5rom hackingshmupsvgbmediafujitsumastermo6demo scenepasswordssquaresoftatari stpaul robsontutorialsdma designteopowerpcfreebsdwiiscitrivianet yarozewindows cepokes32xphotostaitodoomibmgbcuaenecbenj edwardscpccjaguarddrgplpasopianamcoiffrontierculturetnkpethereticzx spectrumdemosnewsinterviewspaingithubarticleapple 2censorshipgp2xpectrumwinampsinclaircopy protectionqlj2megame boynvgc64final fantasyvideostechnotesvcsaction replaydownloadsconversiontvascii artolafnesmagnetic scrollslucasartsgermancastawaymastertronicpluginngcddownloadpcwebayatari 7800recompilernsffusenessmsconsolesmz-80to7delphifrenchmerchandiseagitoshiya takedadtvbox shotswonderswanmanualsauctionsrom hackfpgandsataritandypinoutsmastergearrom listingsmusichead over heelslost sourcebeebsmartphonestrategyrzxosxinterpretersrainbowbiosik+basicnescomputerps2studio 2jeff minterchip8making oflisafrancesonicnesterfmsxscott adamsjavakegsjrpgaltairmacc128simcoupecreatorstype-incaanookonaminewslettersviceapple 1japanesezopharunmaintainedi18nencyclopediaelitetoolretrodevtrs-80resourcesrisc osrottpsxnintendochronologythomsam coupĂ©formatsgeocitiescompilationsdreamcastiafaqukvic-20armwikicapcomsidzx81networkingdescentcomicsluxorcollectingacademicquasi88ralph baeratari 8-bitcd32screenshotsxgspc-fxbard's talewinuaecolemos/2sunosemulationpreservationsegaarchivedgp2xjswbasictimelinerpgsincompletewolfenstein 3dgermanydosboxatari 5200remakesinterpretergraphicsdragonhexengamewindowstoolssnes9xgamasutrawikipediaandroidtgemuquotesx1moviescheatsff7pc-6000streaming