Top:/Vintage Systems/Acorn

Emulators@
Software archives@
1 2 >   Next Page >>
link thumbnail Acorn Rocketship, The cool enja
The famous RiscPC with kitchen sink and pizza oven.
(Added 2003-11-12, 761 hits, more)
link thumbnail About Acorn computers and ARM processors
History, hardware, prototypes, software, operating system, screenshots, and more.
(Added 2003-11-12, 780 hits, more)
link thumbnail Acorn 6502 Microcomputer Kit
About Acorn Computers' first public offering, the Acorn Microcomputer, later known as the Acorn System 1.
(Added 2007-09-09, 602 hits, more)
link thumbnail Acorn Atom pre-history, The
Details and photographs of the industrial and educational systems Acorn produced, before turning to the consumer-orientated market.
(Added 2007-11-08, 539 hits, more)
link thumbnail Acorn Atom Projects

Includes details of a DRAM interface, routines for triangle filling, horizontal line drawing, and ROM reading, a memory map diagram, and a parts list.
(Added 2007-11-08, 547 hits, more)
link thumbnail Acorn Atom Review, The ennl

Detailed information about the Atom, along with photographs, diagrams, and manuals to download.
(Added 2007-11-08, 535 hits, more)
link thumbnail Acorn computer user WWW Server, The
Archimedes-related product info, documents, and technical information.
(Added 2007-11-08, 693 hits, more)
link thumbnail Acorn Electron Lives!
Dedicated to the Acorn Electron. Specs, expansions, hardware projects, game downloads, magazine covers.
(Added 2006-08-17, 921 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 761 hits, more)
link thumbnail Acorn Technical Documents Archive
Archimedes-related technical documents, including many early ones, with a focus on hardware.
(Added 2007-11-08, 727 hits, more)
link thumbnail ARM7 second processor (Sprow's Webpages)
During the development of the original ARM microprocessor, the ARM1, a test system was created called The ARM Evaluation System which ran an enhanced version of BASIC with up to 4Mbyte of RAM. This allowed the developers to try out the new core without needing to design an entire computer, though as it wasn't sold as a commercial system very few were ever built.
[...]
The ...
(Added 2012-10-08, 538 hits, more)
link thumbnail Arthur lives!
Dedicated to Arthur, the Acorn Archimedes' original operating system. ROM image available.
(Added 2007-09-10, 739 hits, more)
link thumbnail BBC Documentation Project
Collects documentation of all sorts on the BBC Micro.
(Added 2003-11-12, 646 hits, more)
link thumbnail BBC Emulation and File Transfer

Information on and programs for transferring files between a PC and a BBC.
(Added 2007-11-08, 572 hits, more)
link thumbnail BBC lives!, The
The net's largest site catering for enthusiasts of Acorn's range of 8-bit micros from the eighties: the BBC models, Electron, Master and Compact, and to a small degree the Atom and Archimedes.
(Added 2007-09-12, 657 hits, more)
1 2 >   Next Page >>
Search:

Tags

thomatari 8-bitgamebasehpdosboxmastertronicvaxdtvguidesstreamingsdlpaul robsonmidiralph baerik+translationsfujitsusierrafdscolumnspcwsonicjapancloneszorktandybox shotscommander keentechnotesitdemo scenegp2xpectrumscreenshotscolecovisioncocointerviewolafnesquotesremakex68000linuxtutorialsos/2italy68kdescentwonderswanepsonmoviespentagonsolarisgbacpcbabyphilipsdocswinuaepointlessbbc basicz-codetoolsmac plusfpgamz-800clubengineosxcharacterscfusefm-7colemdemosquaresoftspritesfamtasiawalkthroughscans8-bitaixschematicsfinal burncivilizationcomputerwindows cems-dospokesflashcartsapogeehi-scoresprogrammingjrpgsvideokonamiwalkthroughslisacasiowindowsphotosmerchandisereviewshomepagesmsxzxpc98onlinefeaturedragonjapanesemapsnetworkingpreservationpc-88sharewareunderdogscapcommz-80iaebay3dogrim fandangorom hackoricsnes9xgeocitiesjum52ddjmagnetic scrollsmp3ultimagradiussolutionsfaqadventure gamesconsolesti-99/4auksonypasswordscompatibilityvic-20david foxshmupfpcealtaircompilerstellagizmondovideo gameslucasartspiratesmanualschronologyz80rom listingsreplicasbard's talesdkpom1space invaderstype-inscidelphifan fictionrick dangerousemulationboycott advanceintellivisioncps2hugues johnsoncollectioncastawayff7apple 2datasheetsconversiontimelinelost sourcecopy protectionvcsasciiartmuseumnews3d realmskigbpatcheswiimsxgameskegsfaqsemulatorsdma designcomicsj2mehereticrpgsideabandonwaregame gearsidexcerptcp/mseriesfmsxsunosaction replaysoundmarat fayzullinsimcoupemipsemulatorneo4allatari 5200rom hackingjupiter aceqlssemhandyatari800imagesascii artdumpingsegapalmostcp/ipzopharcd32sgbmo5trailblazernvgfrancesaturnsg-1000tostnkmega manscorpionarnoldmaking ofzx spectrumvisual basicpc-6000githubcd-imike daillyhistorypetx86bookformatsgraphicshintsataridebuggermastergeartrs-80androidfolkloredownloadplus/4scummfanzinesharpodyssey2specscreativisionapplefan gamespsioninfonesmaemounixmartin korthmanualsfcsnkbiosconvertersmz-700hexenpc-fxftpi18ncreatorsversionsmailing listcollectinggnuboyxm6downloadsadventure gamemodsgremlinusresourcestvastrocadeelitehandheldanalysisindiana jonesp2000wizbugsarcadiacheatsmarcel de kogelllamasoftmagazinesc128n64armvideosoperating systemhuc32xfcedingoojswsoundtracksaquariushumorcartridgesbeosc64gamerichard bannistersovietincompletebasicnesneopoparchimedes65816sinclairrecompilerpocketpcauctionsbooksvectrexti-89open sourceopengladamgame boycompressionfm townsreferenceosf/1pinoutsfan artacorncomposersmark3atomteongpcoverscompilationsassemblerblogbluemsxnecdnafirmwarejrpgspace questpublishermetal gearchip8flyersneo geoforumtriviadarcnesshopibmdreamcastsam coupĂ©installersrisc osrom hacksarcadecodeioslibraryremixesretrodevmacpasopiacartridgenintendoqnxgamecubedoomartworkarchivearticlescaanooedgeyoutubesymbianplayersacademicgp2xfellowguidewscfpsecalculatorpc-98toshiya takedaunreleasedibm pcfrontiervicerzxifstorywikipc enginecomputingmulearticlemac osgamasutragccmessmupengenesis plusvbagp32kim-1softwarecompetitioncommodoreneopocottamigafreebsdvirtual boycultureddrspainpspabc80infocomlynxusenetxgsgeneratorvgbnewsletterspdfapple 2gsngpcagiscott adamspsfmusicsf-7000toolwolfenstein 3djumpmanboulder dashfinal fantasynewsletterwinamplinksgiana sistersbbcxboxnamcocharles macdonaldencyclopediapcsxpowerpcid softwarestrategysmallmultifacepsxx1sc-3000gbchardwaretoshibasource codeshmupslittle johnc166502demosti-92converterdiskmagstaitonesterelectronsupervisionrainbowmediatutorialfrenchmega drivestudio 2spectravideopv-1000online playendingsatari steinterpreterromsjeff mintergallerymonkey islandsms plusmo6benj edwardsamstradndssmartphonecensorshipharvestatari 7800peoplewikipediabasicuae4allmtxrotttgemujaguarbeebhitchhikerflashgermanapple 1ron gilbertbo zimmermanpodcastscummvmduke nukemmamerpgcomputersgplatari starchivedcpuhead over heelsdatabaseadsps2uaecatalognescamputers lynxremakespandoranet yarozeunmaintainedbiographydottgermanygifzx80pluginluxorinterviewsinterpretersmaniac mansionportarstechnicasega cdto7nsfmagazinetoolchainzx81radiomagickitgame designsnatcherzaurusto8ngcdjava.netfrodoxm7copiersintroductionquasi88thalionmastercommercial