screenshots

1 2 3 4 5 >   Next Page >>
link thumbnail About Acorn computers and ARM processors
History, hardware, prototypes, software, operating system, screenshots, and more.
(Added 2003-11-12, 577 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 571 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 982 hits, more)
link thumbnail Alternate Reality Homepage, The Original
FAQ, games and music for download, screenshots, guides and cluebooks, maps, and more.
(Added 2003-11-12, 404 hits, more)
link thumbnail AmigaMemo.com ende
Amiga game museum; classics, rarities, and highlights of Amiga gaming history.
(Added 2007-03-21, 441 hits, more)
link thumbnail Amstrad ESP es translate
almost complete catalog of Spanish games for the CPC, with screenshots and downloads, articles about Spanish software houses, cheats, and a forum; registration required!
(Added 2006-02-24, 934 hits, more)
link thumbnail Apple IIc .dsk Archive fr translate
Small Apple II game and utility archive with screenshots.
(Added 2007-09-04, 561 hits, more)
link thumbnail Area64
C64 games, demos, emus, utilities, and music. Games and demos with screenshots and reviews.
(Added 2007-01-06, 556 hits, more)
link thumbnail Atari Legend
Atari ST game database, reviews and interviews. Downloads require registration.
(Added 2006-09-01, 478 hits, more)
link thumbnail Atarimania
Database of Atari games for 2600, 5200, 7800, XL, XE with scans, dumps, reviews, screenshots.
(Added 2006-08-27, 434 hits, more)
link thumbnail C64 Endings
Screenshots of Commodore 64 game endings
(Added 2006-07-05, 512 hits, more)
link thumbnail C64 Game Guide
This page contains short info and screenshots from many of the old classic C64 games, info on companies and people.
You can also find a little shop-page and a Q&A page here.
(Added 2003-11-12, 487 hits, more)
link thumbnail Chaos Regime, The
Bitmap Brothers tribute
(Added 2003-11-13, 765 hits, more)
link thumbnail Charin's MSX Homepage
Game screenshots, maps, and music, TurboR software, photos, emulators, utilities, documentation, connector pinouts, etc.
(Added 2006-09-24, 444 hits, more)
link thumbnail Commodore 64 Preservation Project
Project aiming to archive pristine versions of original Commodore 64 software, including copy protection. Site features information on C64 copy protection techniques, a disk database, emulator patches, and a collection of Ultimax cartridges with screenshots and technical information.
(Added 2007-12-11, 335 hits, more)
1 2 3 4 5 >   Next Page >>
Search:

Tags

civilizationgradiusms-dosdreamcastsonicassemblerhead over heelsgiana sisterskigbmametnkadventure gamesapple 1duke nukemjavasnkpc98francedemofrontiersolutionsjumpmanarcadeconversionwonderswanbiographypasopiagrim fandangodragonjupiter aceos/2sg-1000compatibilitycatalogtandysoundtracksmark3game boyngcdfrododocspdfexcerpt.netlinksfpsegamebasekonamithomolafneselectronneopocotttoolspc engineendingsopenglmega manusenetscorpionlibraryifxgsftpstrategyelitebeebshopcd-idma designrom hackx1scanswscinterviewssupervisionmz-800bluemsxdingoogamefan artcoversartworkmarat fayzullinmasterfdssunosfm-7usspectravideopetwizlisasoundmagickitpiratespc-98unmaintainedmodsreviewshumorvisual basicjrpgcaanoocastawayi18nremixesstoryfellowconverterscalculatorformatshugues johnsonlost sourceboulder dashoricbasiciasaturnzopharvirtual boyzx80introductioncps2pc-fxcolecovisioncolemconsolespublisherculturenewsaquariusfreebsdmailing listscreenshotsarchimedestoshiya takedaboycott advancecomputingn64sierrafmsxti-99/4asnes9xsega cdinstallersgeocitiesremakeibm pclittle johnsms plusosxsmsprogrammingport32xarnoldfeaturenesfaqdatabaseopen sourcexm665816famtasiadatasheetsmonkey island6502sdlincompletegpl8-bitsimcoupeneo4allzx81pointlessmultifacecasioc128nsf3dochronologyfaqsretrodevzaurusatomspecssquaresofthucscott adamsthalionrichard bannisterfm townsndsascii artcheatswinuaetimelineedgebbc basicgizmondoralph baercharles macdonaldinterviewtcp/ipchip8adamsc-3000adventure gamemediawii68kdiskmagsfirmwarec16astrocadeqnxmaniac mansionvcsmanualsamstradschematicsblogz-codecocoarticlelynxdemo scenesovietzx spectrumplus/4copiersfinal burncp/mcommander keentrs-80pc-6000gccapple 2ioscollectionto8space invaderspeopleddrresourcesflashcartridgewikipediademoscompileratari800camputers lynxtvcompressionhereticfpgagamespluginphilipswindows cevideosmo5referencesharphandymastergearnet yarozewalkthroughtaitoquotestutorialsnvgx68000remakesspace questcopy protectiondownloadsonymetal gearlucasartspatchesgermanymapsrainbowaction replaymagazinesjswemulatorclonesstudio 2vectrexjaguarsmartphone3d realmsrom hacksauctionssegacpcbiosyoutubegp2xpectrumpspideatarimz-80vbamo6hi-scorescommodorehandheldarchivecompilationsngpcfan gamespowerpcmoviesto7pcsximagesx86guideforummusicgame designgenesis plusmsxgp32ukcomicsabc80rottspainepsonquasi88toolflyerspsiontechnotesfanzinesharewareonlinesinclairpentagonhintshistorygp2xvic-20merchandiseitalybenj edwardsuaeteobard's talegnuboyps2enginemega drivecartridgesatari 8-bittoolchainspritesdnascummreplicasjum52amiganecmagazinebugsversionsarmngppcwhpgermancd32debuggerradioatari 7800collectingcommercialcreativisionti-89neo geoasciiartmarcel de kogelpocketpcintellivisiondottultimafan fictiondosboxtutorialemulatorskegscreatorsebayvideotriviasnatcherxzxinterpreterencyclopediahomepageseriesrpgacornff7infonesaltairunixsfcsdkgbcxm7ssemjapaneseclubddjgamecubemtxmaking ofrisc ossam coupĂ©mp3messmuseumcomputersgame gearnamcowindowsneopopinfocomsource codemipsstellastreamingmastertronicrecompilerik+wolfenstein 3dxboxtgemuconvertermz-700psxdelphimupenrpgsrick dangerousqlz80cpunintendoacademicunreleasedpsfpreservationindiana jonestranslationsid softwaresymbianjapanti-92pandorashmuparstechnicanetworkingibmbeosgamasutratoshibaapplesidmac pluslinuxflashcartsodyssey2frenchmac osluxoratari 5200basicnesc64hardwarebooksosf/1playerspasswordsdtvdarcnesmuledumpinghitchhikerpodcastarcadiaemulationaixzorkrzxgbauae4allvaxpaul robsonmanualbox shotsinterpretersapogeeagirom listingspokeskim-1smallunderdogsdavid foxcodeatari stemike daillyfujitsubabyitpinoutsdoomcomputerfolkloregallerywikifpcegeneratornewslettersarchivedsf-7000jrpgstype-inscibookcharactersnewslettersgbcapcomgraphicscensorshipabandonwareromsscummvmbo zimmermanp2000shmupsanalysisvgbdescentpv-1000hexenrom hackingapple 2gsjeff mintergremlincolumnsarticlesvideo gamescadsonline playmacgifsoftwaretosfcecompetitionguidesandroidfusewinamptrailblazermidij2medownloadsllamasoftoperating systemphotosmartin korthviceron gilbertgithubcomposerspc-88magnetic scrollsmaemobbcpalmosnesterpom1walkthroughsharvestatari stsolarisfinal fantasy