reviews

1 2 3 4 5 6 7 8 >   Next Page >>
link thumbnail Digital Press cool
Classic gaming fanzine, collector's guide, vintage systems knowledge base, reviews, media, regular columns. Covers an amazing breadth.
(Added 2003-11-12, 835 hits, more)
link thumbnail GameFAQs cool
GameFAQs features video game cheats, reviews codes, and guides for all platforms, past and present.
(Added 2006-07-06, 553 hits, more)
link thumbnail I ♥ The PC Engine (Magweasel) cool
Kevin Gilford's excellent reviews of PC Engine games and related items providing a lot of historical background.
(Added 2014-03-04, 635 hits, more)
link thumbnail SHMUPS! cool
Showcases the best 2D shooters around. Excellent reviews.
(Added 2003-11-12, 718 hits, more)
link thumbnail Acorn Arcade
All about games for RISC OS computers. Hints, reviews, interviews, columns, and liberated games for download. Also has a demo section.
(Added 2006-08-17, 530 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 482 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 425 hits, more)
link thumbnail Adventure Classic Gaming
Dedicated to classic and retro adventure gaming. Reviews, exclusive interviews of developers and publishers, features on adventure gaming, and game cheats.
(Added 2006-09-24, 420 hits, more)
link thumbnail Adventure Games Coalition
Walkthroughs and reviews for many adventure games.
(Added 2006-09-24, 314 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 859 hits, more)
link thumbnail Amiga Flame
News and reviews of Amiga games. Also contains tips and cheats, demos to download and a section for game developers.
(Added 2007-12-10, 304 hits, more)
link thumbnail Amiga Games Database, The
Reviews of a great many Amiga games.
Welcome to the Amiga Games Database. It's purpose is to provide Amiga games players with an informed but subjective opinion on a wide range of games. A vast amount of Amiga titles have been written, some of them more than a decade ago. We've all come across some awful software in our time, but for many of us, there's a surprising quantity of undisc ...
(Added 2006-09-13, 314 hits, more)
link thumbnail Amiga Reviews ende
This site features thousands of Commodore Amiga game reviews which originally appeared in magazines between 1988 and 2000.
(Added 2006-09-01, 312 hits, more)
link thumbnail amstradmuseum.com enes
The Amstrad computers museum. Reviews (Spanish only), interviews, documentation, CPC 472 information, game inlays, small tape archive.
(Added 2006-08-11, 571 hits, more)
link thumbnail Area64
C64 games, demos, emus, utilities, and music. Games and demos with screenshots and reviews.
(Added 2007-01-06, 483 hits, more)
1 2 3 4 5 6 7 8 >   Next Page >>
Search:

Tags

psionrom hackingcollectingi18nrottpc-98enginegamasutrahandyatari 5200colemgamesindiana jonesddrwinampgenesis plusencyclopediasc-3000nsfsidfm-7pc98walkthroughsneopopitfpsesource codemonkey islandfolklorehintsguideapple 2gsmz-80screenshotsgifjswfm townscopiersthaliondatasheetspasopiati-89elitespace questgp2xpectrumlinuxwizcharactersbeebwinuaeintellivisionpom1interpretergbaauctionssolarismulebasicsoundtracksthomvic-20aix8-bitmuseumjum52sdkusenetsfcngppatchesdatabasesgbscansdavid foxjeff minteratari stendsaltaircompilationspcwxgsretrodevadsremixesvgbfan artwonderswanosxflashresourcesforumsinclairaction replaymarcel de kogelseriescoverspentagonprogrammingdtvti-99/4aatari 7800atari stzx80rom hackscreatorsfamtasiapandoralisasierrarpgstoshibaatarixm6mupento7portspectravideofpceromsbiosx68000shopneo4allgiana sistershucdreamcastkigbz-codesg-1000spainreplicasopen sourcezx spectrumadventure gamerpgblogvisual basicremakespc-6000githubbeoskim-1descentunderdogsdma designarticlesik+cartridgelibrarywscmusicdownloadto8qlatari800mo5cpumaps65816windowsvectrexcapcommartin korthgradiusn64sf-7000manualtcp/ipodyssey2ti-92hardwaretgemuconversionatomsunoswiissemralph baercomputertype-inimagesbasicneszopharshmupskonamitrailblazeradventure gamesdemosremakekegsnvgdottintroductionmarat fayzullingallerydebuggerllamasoftquasi88game designdingooascii arthumorhomepagevideoappleid softwaresmsbabycps2agims-dosnesteraquariusngpcpalmosmultifacesega cdvideospocketpcepsonpublisherartworkdoomff7ioscp/m6502openglasciiartyoutubemidicompetitiongamecubetnkgplhi-scoreslucasartsonline playchip8gbcgame gearcompatibilitycd32peoplefdspinoutsbbc basicquotesacornmaniac mansiongeneratorstudio 2merchandisearticlejapancalculatorconverterukhpsnkculturemo6columnssdlmtxpetpsf3d realmsassemblervicesoftwarewalkthroughsnes9xlinksdownloadsfreebsdpcsxz80vaxunixpdfpluginbooksc16chronologysonicpaul robsonrecompilerfanzinecocorzxmsxsam coupégamebasetoolchainddjtriviabox shotsfirmwarexm7trs-80camputers lynxmike daillysimcouperom hackpsxversionsdarcnesarstechnicasoundfujitsump3creativisionspace invadersgrim fandangofan gamestaitoconsolescommander keenadamtoshiya takedafranceelectronlost sourcebluemsxpreservationmega mangame boyjrpgiaabandonwaretimelineradioolafnesemulatorwikilynxgizmondoj2mestreamingplus/4duke nukemcartridgescasiogcccpcemulationtranslationscpiratesmodshereticabc80dragonsms plustoolcollectionebaysnatcherrainbowngcdcivilizationstrategypowerpcboycott advancesegapointlessvirtual boybenj edwardsphotossmallxboxqnxstorymamemaemocomposersnamcogermanfrenchwindows cedemo3doshmupmetal geardosboxzorkgp2xcolecovisionarchivediskmagsibm pcfpgabugssaturncastawaypc engineidesharewaremac plusjavafinal burndnacharles macdonaldnintendo32x68kastrocadeinterpretershead over heelsunreleasedexcerptcommodoretvflashcartsmastergeardelphimagazinesneo geoflyerssharptechnotesharvestos/2arcadeifarmpokesbbcmaccheatsnecuae4allplayerspc-88ps2uaeinterviewoperating systemschematicshexenedgeusmark3neopocottnewsletterapple 2ultimaboulder dashmipsreviewswikipedianetworkingibmx1onlinejrpgsmoviesapple 1mastermz-800mailing listdocstutorialmaking ofhandheldron gilbertrichard bannistercommercialscummvmcomicsjapanesebookhitchhikerscifceamstradspecspv-1000video gamesguidesinfocomsovietbo zimmermanmagnetic scrollscaanoofaqzx81scummarchivednet yarozeconvertersgeocitiesoricamigasymbianfrodomessatari 8-bithistoryvcsc64final fantasysquaresoftemulatorsmz-700gamepodcastfrontierosf/1gp32mediaxzxmanualsp2000copy protectionwolfenstein 3dinterviewstandyfmsxinstallersfan fictionstelladumpingzauruscomputingcodenewslettersjumpmancompressiongnuboyincompleteapogeedemo scenecensorshipsupervisionmagickittutorialsjupiter aceacademiccd-itoolsreferencephilipsmac os.netarchimedesandroidtosscott adamsfaqsgermanyclubgraphicsc128spritesrisc osbiographysolutionsluxorscorpionvbahugues johnsonmastertronicsmartphonebard's talerom listingsrick dangerousftpmega drivearcadiafeaturemagazinepc-fxformatscatalogjaguarpspnesunmaintainedcompileritalypasswordsarnoldsonyfellowteonewsanalysisinfonescloneslittle johnendingsx86gremlincomputersfuse