reviews

1 2 3 4 5 6 7 8 >   Next Page >>
link thumbnail Digital Press cool
Classic gaming fanzine, collector's guide, vintage systems knowledge base, reviews, media, regular columns. Covers an amazing breadth.
(Added 2003-11-12, 863 hits, more)
link thumbnail GameFAQs cool
GameFAQs features video game cheats, reviews codes, and guides for all platforms, past and present.
(Added 2006-07-06, 571 hits, more)
link thumbnail I ♥ The PC Engine (Magweasel) cool
Kevin Gilford's excellent reviews of PC Engine games and related items providing a lot of historical background.
(Added 2014-03-04, 671 hits, more)
link thumbnail SHMUPS! cool
Showcases the best 2D shooters around. Excellent reviews.
(Added 2003-11-12, 747 hits, more)
link thumbnail Acorn Arcade
All about games for RISC OS computers. Hints, reviews, interviews, columns, and liberated games for download. Also has a demo section.
(Added 2006-08-17, 548 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 504 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 451 hits, more)
link thumbnail Adventure Classic Gaming
Dedicated to classic and retro adventure gaming. Reviews, exclusive interviews of developers and publishers, features on adventure gaming, and game cheats.
(Added 2006-09-24, 437 hits, more)
link thumbnail Adventure Games Coalition
Walkthroughs and reviews for many adventure games.
(Added 2006-09-24, 335 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 885 hits, more)
link thumbnail Amiga Flame
News and reviews of Amiga games. Also contains tips and cheats, demos to download and a section for game developers.
(Added 2007-12-10, 321 hits, more)
link thumbnail Amiga Games Database, The
Reviews of a great many Amiga games.
Welcome to the Amiga Games Database. It's purpose is to provide Amiga games players with an informed but subjective opinion on a wide range of games. A vast amount of Amiga titles have been written, some of them more than a decade ago. We've all come across some awful software in our time, but for many of us, there's a surprising quantity of undisc ...
(Added 2006-09-13, 330 hits, more)
link thumbnail Amiga Reviews ende
This site features thousands of Commodore Amiga game reviews which originally appeared in magazines between 1988 and 2000.
(Added 2006-09-01, 328 hits, more)
link thumbnail amstradmuseum.com enes
The Amstrad computers museum. Reviews (Spanish only), interviews, documentation, CPC 472 information, game inlays, small tape archive.
(Added 2006-08-11, 587 hits, more)
link thumbnail Area64
C64 games, demos, emus, utilities, and music. Games and demos with screenshots and reviews.
(Added 2007-01-06, 503 hits, more)
1 2 3 4 5 6 7 8 >   Next Page >>
Search:

Tags

ndsvectrexfinal fantasyascii arttutorialsfeaturetrailblazerfujitsudemosaction replaybiography32xti-92bluemsxsgbasciiartcd32armapogeecastawayflashcartszx81gp2xvisual basicatari 7800copy protectionculturefreebsdquotesonlineradioneo geofan fictionduke nukemsc-3000dreamcastsolutionsbo zimmermanimagesik+neopopfaqsmark3risc osgradiusmessngcdmega manreplicasdatabaselost sourcemartin korthmastertronicgplvic-20smartphonedragondoomlinkstriviacsaturnnintendokegsemulatorsource codemediax1translationsjswpcwtosunderdogsluxorsfcgccgbcmega drivevgbschematicslinuxstrategythomcpucivilizationzopharmo6altaircolemdownloadsgp32javacompilerx86germanconsolesdtvmtxsquaresoftmuseumjrpgfrodorpgshandheldwindowsboulder dashmagickitnamcofrontierdosboxvcsemulationfan artapple 2gsspace invadersmarcel de kogelmagnetic scrollsshmupsmanualsintroductionwinampcartridgesflyersfpgacaanoopom1comicsqnxmagazinesn64astrocadeneccolumnssonyapplewizgremliniffan gameswikibbcdelphiinfocomarchivewalkthroughdemo sceneneo4allbasicnesfusep2000atariarcadiaonline playwalkthroughslucasartsto8soundrichard bannisterunreleasedsinclairscummconversioninfonesatari 8-bitrpghucsoundtracksquasi88aixcharactersusssemassemblercreatorsnesterdocsarticlegame boypandoragenesis plusremakecartridgegrim fandangofellowprogrammingadammz-800germanyebaynvgjapanesevideocopiershexenartworkpv-1000pluginsimcoupemetal gearxboxfcemamecamputers lynxpc-fxosf/1ultimahi-scoresfdssharewareitdebuggertoshibaspace questddrdiskmagsteopatchesnetworkingralph baerinterpreterps2j2mepsfshopinterpretersgeneratorjrpgselectron3d realmsremixescd-icapcomtoolchainff7adventure gamepcsxspritescomputingtaitomulefirmwareinterviewspsptoolsfamtasialynxarchimedeschip8jumpmanhereticcp/mfpcecommodorecompetitiondma designxm7interviewfmsxelitemonkey islandhead over heelsspainarticlesxm6psxadventure gamesmagazinecompressionwinuaegallerypc-98id softwaredavid foxopen sourcebard's talewikipediasovietpalmostrs-80encyclopediasoftwarec64pokestoshiya takedareferencensfspectravideofolkloregbangpcsierrarom listingsconverterscummvmvaxdumpingepsonpsionforumgame designdatasheetswonderswanidestudio 2gifindiana jonesthalionodyssey2compilationsarcadebooksmidicharles macdonaldmastergearflash68kbbc basicmapsjeff minterendingsmo5cpchandypc-88uaebiosbox shotsintellivisionsymbianreviewscommercialpentagonnewsletterscoverspublishersonicpc98llamasoftincompletejapancheatsblogos/2operating systempeoplezx80academicedgez80vbaadsrom hackpinoutsbookhugues johnsonvideo gamespointlessrick dangerouscomputerssnes9xseriesmike daillybeebmz-80basicanalysisgithubcreativisiontvkigbbabyacornsg-1000plus/4abandonwareddjinstallersemulatorswscretrodevscorpiontandygeocitiesfinal burntutorialpc enginegameti-99/4azx spectrumgamesvideospreservationsnatchercomposerssf-7000xgs65816descentpc-6000fm-7windows ce3dowiikim-1masterrainbowfm townsjupiter acepowerpcsam coupéamigalisafanzinedarcnesyoutubesms plussdlsega cdnewslettersmallmarat fayzullinremakesunixagixzxtcp/ipneopocottjum52bugsitalyromsolafnesatari 5200zorkscott adamsgp2xpectrumscreenshotsaquariusstoryhumorbenj edwardsdemomaemoandroid.netqlsupervisioncomputercompatibilityhpmp3toolc16auctionslittle johnosxms-dosexcerptpocketpccollectionharvestc128ron gilbertsmspetcollectingrzxopenglfpsecocognuboyoricpaul robsonti-89specswolfenstein 3dlibrarycps2chronologyformatsmodssnknesmaniac mansionfrancemusiccensorshipmupenresourcesi18nsdkatari sterom hacksmac plusfaqtype-insidmaking ofscansscidottportmultifacezaurusmipsguidemacclonescommander keensharpapple 1vicepdfdownloadcatalogtgemupasswordsunmaintainedplayershistoryto7coderottarstechnicastella8-bitrom hackingvirtual boymsxiossolariscalculatortechnotesguidesftpstreaminggiana sistersfrenchhomepage6502mz-700merchandisepasopiacolecovisionpiratesjaguariaibmgamebaseatomrecompilerz-codemanualamstradhitchhikerenginesunosversionstimelinecasiopodcastarnolduae4allgame gearhintsnet yarozeabc80photosboycott advancex68000archivedbeosnewsukatari stdingoohardwaregamasutradnamoviesgamecubegraphicsmailing listtnkclubconvertersusenetapple 2segaatari800ibm pcmac osgizmondongpkonamishmupphilips