reviews

1 2 3 4 5 6 7 8 >   Next Page >>
link thumbnail Digital Press cool
Classic gaming fanzine, collector's guide, vintage systems knowledge base, reviews, media, regular columns. Covers an amazing breadth.
(Added 2003-11-12, 1057 hits, more)
link thumbnail GameFAQs cool
GameFAQs features video game cheats, reviews codes, and guides for all platforms, past and present.
(Added 2006-07-06, 661 hits, more)
link thumbnail I ♥ The PC Engine (Magweasel) cool
Kevin Gilford's excellent reviews of PC Engine games and related items providing a lot of historical background.
(Added 2014-03-04, 941 hits, more)
link thumbnail SHMUPS! cool
Showcases the best 2D shooters around. Excellent reviews.
(Added 2003-11-12, 915 hits, more)
link thumbnail Acorn Arcade
All about games for RISC OS computers. Hints, reviews, interviews, columns, and liberated games for download. Also has a demo section.
(Added 2006-08-17, 651 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 620 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 575 hits, more)
link thumbnail Adventure Classic Gaming
Dedicated to classic and retro adventure gaming. Reviews, exclusive interviews of developers and publishers, features on adventure gaming, and game cheats.
(Added 2006-09-24, 541 hits, more)
link thumbnail Adventure Games Coalition
Walkthroughs and reviews for many adventure games.
(Added 2006-09-24, 444 hits, more)
link thumbnail Adventure-Archiv de translate
Large database of adventure games with short descriptions, box and screenshots, and links to publishers, developers, related sites, reviews, and solutions.
(Added 2006-09-24, 1051 hits, more)
link thumbnail Amiga Flame
News and reviews of Amiga games. Also contains tips and cheats, demos to download and a section for game developers.
(Added 2007-12-10, 406 hits, more)
link thumbnail Amiga Games Database, The
Reviews of a great many Amiga games.
Welcome to the Amiga Games Database. It's purpose is to provide Amiga games players with an informed but subjective opinion on a wide range of games. A vast amount of Amiga titles have been written, some of them more than a decade ago. We've all come across some awful software in our time, but for many of us, there's a surprising quantity of undisc ...
(Added 2006-09-13, 411 hits, more)
link thumbnail Amiga Reviews ende
This site features thousands of Commodore Amiga game reviews which originally appeared in magazines between 1988 and 2000.
(Added 2006-09-01, 420 hits, more)
link thumbnail amstradmuseum.com enes
The Amstrad computers museum. Reviews (Spanish only), interviews, documentation, CPC 472 information, game inlays, small tape archive.
(Added 2006-08-11, 697 hits, more)
link thumbnail Area64
C64 games, demos, emus, utilities, and music. Games and demos with screenshots and reviews.
(Added 2007-01-06, 592 hits, more)
1 2 3 4 5 6 7 8 >   Next Page >>
Search:

Tags

schematicselectronfaqssimcoupespaintechnotesvicefan arthi-scoreszx spectrumnamcowonderswanngpcomicscaanoocompressionamigasfczx81llamasoftmo5tutorialscopierspasswordsjswmac osgeocitiesmodsagionlinewinuaespace questnvgtoshiya takedamike daillycommercialti-99/4aforumnestersmsflyersmsxtriviaarchimedesaltairinterpreterradiofan fictionx1rom hackingj2medottmz-80consolesfusebugsfaqfrancerottduke nukempsxlinkspentagonwolfenstein 3dms-dosepsonnecolafnescoderemakesdownloadsnksgbwindowspasopiacolecovisionsam coupéphotosbeosreferencefujitsuhandheldpcwbo zimmermanmagazine65816cheatsxgsgamecubemz-700segasierrapreservationsonybooksatari 5200timelinediskmagsdma designemulationrick dangeroussnes9xcpubeebpiratesfreebsdplayersnewslettersdemotos3dojaguargame boyscorpioncharactersandroidhitchhikerguidescolemedgefdsvideozx80sdlmp3x86ti-89sega cdps2delphimediaadventure gamesi18nftpencyclopediacd-ifinal fantasyfm townsfpseonline playfamtasiapetchip8fcepdfreplicasheretictools8-bitrisc oscpcik+xm7vaxtandykim-1quotesmaniac mansionanalysisnintendonet yarozeoricjupiter acendsthalionscummbiosgizmondocensorshiparstechnicasupervisionpc enginekonamidebuggerfpgaintellivisionmz-800competitioncollectionvic-20boycott advancenetworkingversionscolumnsgraphicsconverterneo4allsidmagickit32xgp2xinfocom6502compilergermanysc-3000gamesharvestmidimanualsebayromshardwareaction replaylittle johnaixmagazinessolutionsfellowsaturnpspneopocottreviewsdatabasegeneratormulestrategykigbguideapple 2gsdocs3d realmsculturemaking of.netmacartworksharewaren64iascummvmquasi88martin korthapogeeqlflashcartsapple 2homepagespecsseriescomputersdemosfirmwarepc-fxindiana jonespsionidearchivehead over heelshintsacademicabandonwarepv-1000philipsmarcel de kogelbox shotsbasicgcchandysdksoundtracksbluemsxron gilbertzaurustoolchainprogrammingscanscps2blogosxusenetshmupbiographyhexenwinampsonictoolflashcartridgessovietamstradsinclairauctionsremakerzxmanualrecompilerinstallerswizgiana sistersmark3doomsmallpc-98ibmmaemointerviewsdnafinal burntoshibagp2xpectrumbookastrocademipsdragonvirtual boybbc basiccartridgefrontierxboxportkegsto8ifsymbiangamasutraspectravideooperating systempeopleapple 1musicwalkthroughsjrpgsbenj edwardsvideo gamesjum52grim fandangofeaturevgbtranslationsmesscocowiiyoutubefm-7mastergearcomposersasciiartpalmosmoviestnkmarat fayzullinadamsoftwareintroductionbard's talez80fanzineibm pcodyssey2mo6rpgsfmsxgradiusinfonesplus/4cp/mjumpmancalculatorjapanascii artcommodoreteomerchandisepointlessemulatorsneo geodescentboulder dashzopharelitearmspriteshistoryz-codegame designunixc64ddrscott adamsretrodevrichard bannisterlost sourcemailing listlibraryarcadiamameemulatoratariapplecharles macdonaldosf/1gamebasepcsxtrs-80david foxussunosmonkey islandos/2babylucasartsatari 7800uaeukcastawaythomx68000vectrexarticlesf-7000adventure gamechronologyc128sms plusarcadepinoutsxzxvcsadscoversfrodorom hackmasterarticlesiosconversioninterpretersvisual basichugues johnsonngcdunmaintainedgallerynewsclonesendingsssemresourcesarnoldmapsacorn68kp2000studio 2mupenitwikirpgpaul robsonsciwalkthroughto7atari steformatscomputerxm6computingunderdogsdingoongpcnesddjbbcgenesis plustcp/ippokesdtvexcerptshmupscivilizationpocketpcsmartphonevbasg-1000javajapanesepc-6000lisasource codegermanpc98psfstreamingcasioatari stnsfgnuboypom1converterscopy protectioncompatibilityjrpglynxmetal geartype-inremixestvdumpingpodcastc16folklorerom hacksdemo scenejeff mintertgemuopenglaquariuslinuxultimazorkneopopitalyinterviewmastertronicpandorapatchessharpgplatari 8-bitmega manwscgbcatari800id softwarecommander keengifgame gearmuseumcd32screenshotscgbaclubsquaresoftfpcegameabc80hucmega drivedreamcastgremlinwikipediatutorialcamputers lynxengineimagesmac plusincompletecatalogrom listingsdosboxmagnetic scrollspc-88ff7compilationspublisherdarcnesstellapowerpcluxorfrenchsolarisassemblerhpsnatchernewslettermultifaceuae4allti-92qnxdownloadsshopopen sourcebasicnesatomfan gamestaitodatasheetsralph baerwindows cesoundarchivedspace invadersunreleasedvideoscreativisiongithubcapcomcollectingtrailblazerrainbowcreatorsgp32pluginhumormtxstory