plugins

link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1129 hits, more)
Search:

Tags

harvestreviewsidesharewarehintsiacloneswonderswanmupenpodcastsnkndssc-3000colemcalculatorvideo gamesapple 2graphicsfaqmtxgnuboycomposerscompatibilityindiana jonesspace invadersmulehugues johnsoncd32analysisfrodoascii artaquariuscivilizationneopocottcodecreatorsflyersmsxsovietdemo scenearticleunmaintainedcastawayshopmz-80japandownloadphotossdlseriessmartphonerpgsmovieselitephilipsadamabc80assemblerspritesrpghomepageff7interpretersoundtracksbasicgamecuberom hackingcaanooarcadesquaresoftik+rom hackscapcomz-codepc-88pc-fxfinal fantasypv-1000chip8windows ceremixesmanualcomicscpuos/2ngppiratesviceacornmega mansonygame designclubti-92francedemosmanualsifvaxvic-203d realmszx spectrummike daillypublisherpaul robsonbookepsondatabasecps2studio 2beebwindowsimagescollectingmusiccpcdiskmagssoundresourceswikipediaapogeepcwcomputershexenbbcarchimedesthalionmodsandroidsg-1000neopopsymbiancopiersgp32final burntranslationsi18ntoolchaingp2xgbati-89fpsefdsmediamagazinesshmupsvcscompetitionatari800fceabandonwarecreativisionmo6mac plussdktaitofm-7xzxboulder dashsolarisnesunreleasednetworkinghead over heelsxgsqnxromsdoomapplehumorfirmwarequasi88armwolfenstein 3dconversionasciiartfmsxiosstory32xatarixm6maemogremlinrom listingsfrenchcasiohi-scoresfrontiergizmondogbcatari stnewslettersonline playvideosfpga.netvectrexcharactersdocsgame boyxm7atari 5200dumpingrottluxorcartridgeid softwareunixc128githubebayatari stemarat fayzullinto7ps2gifamigaconverterdma designcatalogmagnetic scrollstutorialszopharwinuaesaturnc64walkthroughsopenglspectravideobluemsxremakesbeostgemupointlessuae4allsoftwaresms plustandyx86compressionstellapsionmagazineitalycompilerremakezorkosxscidottsmsfm townsvbaapple 2gsultimauktutorialportjavatcp/ipadssimcoupebasicnesgamasutraithereticdatasheetsnsfhandylibraryarchivedgermanykim-1newsinterviewsmapsretrodevstreamingbard's taletosexcerptmz-700mastergearflashcartssfcpreservationddjnamcoscummscreenshotsconverterswiioriccolumnssam coupĂ©gamesarnoldmarcel de kogelyoutubeacademicnintendo68kcolecovisiontrailblazerspecsgallerynecjum52timelinetriviacharles macdonaldsmallarticlesarcadiaboycott advancecp/mz80scansenginexboxversionsdownloadssf-7000bo zimmermanpocketpcuaegermanlynxpc-6000agiwizaixedgeneo4allron gilbertpspnet yarozealtairtoolscartridgesschematicsgrim fandangococouspentagonpc98patchesforumwinampbiographytvdosboxc16gccpasopiacomputerpcsxmultifacehardwarethomelectronmp3sharpibm pcrisc osrick dangerousadventure gamespc-98dragonbox shotssegadarcnesmuseumchronologysnatchercopy protectionkonamicomputingmartin korthpeopleemulationreplicassinclairauctionsp2000gamepc enginesource codemipsneo geoconsoles65816sonicmonkey islandsnes9xopen sourcegeocitieshucsgbapple 1teobioscollectionplayerscompilations3doplugininterpreterscamputers lynxfamtasiastrategyscorpionjupiter acehp8-bitddrshmuphandheldgplastrocadedtvfpce6502emulatorsformatsinfonesguidehistorypokescommercialibmjrpgsfujitsufan gamesolafnesduke nukempalmosmo5toolspainlucasartsinfocomvisual basiccommodoreendingspsxdebuggermastertronicjumpmancheatssega cdreferencemaniac mansionpom1newsletterfanzinenvgssemdavid foxunderdogsmactnkscott adamsdreamcastplus/4kegsdingoosierraatari 8-bitinterviewincompletedescentemulatorquotesn64ms-doslost sourcemega drivewikitrs-80ngcdllamasoftmessencyclopediaralph baercoversrainbowfreebsdrom hackvideofusebabyblogj2megamebasepinoutsflashqljeff minterfolkloreadventure gamewalkthroughintroductionvgbdelphizx81radiotoshibabugsngpcmasterjaguarlisacd-imetal gearfan artmagickitgame gearx1fellowamstradlinksrichard bannisterinstallersbenj edwardsspace questscummvmgenesis plusmark3kigbpsfti-99/4ageneratorodyssey2cosf/1virtual boymailing listprogrammingbbc basicintellivisioncensorshipgiana sistersarstechnicalinuxdnademoatari 7800mz-800sidartworkjrpgtechnotessolutionspetlittle johnpandorax68000atomaction replayculturepowerpcsupervisionguideswscarchivemerchandisetype-inpdffaqsmamejapanesegradiuspasswordsmidito8zaurusgp2xpectrumjswmac ostoshiya takedarecompilerzx80operating systemsunosrzxnesterfeaturefan fictionmaking ofbookscommander keenhitchhikerftpusenetonline