
1 2 3 4 5 6 >   Next Page >>
link thumbnail DOSBox cool
Excellent PC emulator with built-in DOS, great for playing DOS games and even DOS-hosted emulators.
DOSBox also emulates CPU:286/386 realmode/protected mode, Directory FileSystem/XMS/EMS, Tandy/Hercules/CGA/EGA/VGA/VESA graphics, a SoundBlaster/Gravis Ultra Sound card for excellent sound compatibility with older games...
(Added 2003-11-12, 551 hits, more)
link thumbnail higan cool
Formerly known as bsnes.
higan is a Nintendo multi-system emulator that began development on
2004-10-14. It currently supports the following systems:
  • Famicom
  • Super Famicom
  • Game Boy
  • Game Boy Color
  • Game Boy Advance
  • Nintendo DS
higan also supports the following subsystems:
(Added 2007-08-15, 930 hits, more)
link thumbnail UAE Amiga Emulator cool
Amiga emulator for Unix-like systems that has been ported to a wide range of other platforms.
UAE is a mostly complete software emulation of the hardware of the Commodore Amiga 500/1000/2000. A Commodore Amiga, for those who don't know, is a 16/32 bit computer system based on the Motorola 680x0 CPU and a few specially designed custom chips that provide very good graphics and sound ca ...
(Added 2003-11-12, 599 hits, more)
link thumbnail 1541EMU
Commodore 1541 disk drive emulator for DOS. Use your PC as a disk drive for Commodore computers. Supports fastloaders, but needs a special cable.
With this software you can use your PC computer as a disk drive for those 8-bit Commodore home computers that are equipped with serial bus (this includes for example C-64, C-128, VIC-20, Plus/4 and C-16). Instead of recognizing just t ...
(Added 2003-11-12, 525 hits, more)
link thumbnail - Computers
Archive of the Apple Assembly Line newsletter and Computist, Understanding The Apple II, and software for the Apple //e and IIgs released under the GPL.
(Added 2007-09-06, 378 hits, more)
link thumbnail ArcEm
Archimedes Emulator for Unix and RISC OS. Open-source emulator of an A400 series machine. An emulator project that simply refuses to die, its ten-year release cycle notwithstanding.
(Added 2003-11-12, 438 hits, more)
link thumbnail

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 639 hits, more)
link thumbnail Bleep!
Bleep! is a music player for NSF and GBS files. It comes in two versions:
  • Bleep.exe: Standalone text-mode player for DOS and Win32
  • in_bleep.dll: Input plugin for Winamp 2.x/5.x
(Added 2006-07-06, 470 hits, more)
link thumbnail Brandy Basic V Interpreter, The
Brandy is an interpreter for BBC Basic (or Basic V as it is refered to here) that runs under a variety of operating systems. Basic V is the version of Basic supplied with desktop computers running RISC OS.
(Added 2003-11-12, 438 hits, more)
link thumbnail Castaway
Atari ST and 68k emulator for Linux, Windows, and other systems for which SDL is available.
(Added 2006-08-17, 504 hits, more)
link thumbnail CloneKeen
Almost complete clone of Commander Keen: Invasion of the Vorticons by ID Games.
In addition to emulating the gameplay of the original Commander Keen games, CloneKeen has some extra features which weren't present in the original game. You can play with 2 people, there is a built-in level editor for creating and sharing your own user maps, and there are some for-fun options such as Full ...
(Added 2006-02-10, 505 hits, more)
link thumbnail DAPHNE Arcade Laserdisc Emulator
Laserdisc arcade game emulator for Linux, Windows, and Mac OS X.
(Added 2003-11-12, 543 hits, more)
link thumbnail Digger Remastered
port of 1983 PC game "Digger" for many platforms; the source codes for the remake (GPL) as well as the original game are available. Also available are the binary and source code for Styx, and other Windmill Software releases, as well as the story of Windmill Software, complete with photos from the olden times.
(Added 2006-02-10, 547 hits, more)
link thumbnail DOSBOXDC
Sega Dreamcast port of DOS PC emulator DOSBox.
(Added 2006-08-17, 548 hits, more)
link thumbnail DOSEMU
DOSEMU stands for DOS Emulation, and allows you to run DOS and many DOS programs, including many DPMI applications such as DOOM and Windows 3.1, under Linux.
(Added 2006-07-06, 339 hits, more)
1 2 3 4 5 6 >   Next Page >>


jswpc-98magazinexm7marcel de kogeldumpingmagickitpc-fxflashcartssnkformatsinterviewsrainbowemulatorfm townscp/mpspibmforumgame68kfdsadscensorshipinfocominterpretersgiana sisterslibraryemulationto8palmosbluemsxshmupsatari 8-bitgermanygbapatcheshitchhikerwscmaking ofxzxmagazineslost sourcemanualspace questdemosz-codendsjum52kegsarchiveonline playfrenchdescentphilipsteocodesnatchertvhpmaccheatsdreamcastmark3videoswizmega drivesovietxboxdnacoverssquaresoftdatabaserom hackngpccompetitiongithubvbaddrngcdabandonwarexm6pv-1000ff7solarisfcejapanromscreativisionosxmupenmultifacebasicsinclairsgbcharactersjupiter acecd-icaanoocomposerscompilationsrecompilerarcademaemorom listingsfolkloregrim fandangoquasi88handheldcartridgesnestermoviesshopjapaneseaquariusschematicsscorpionoricscummvmto7demo scenecharles macdonaldnvgzx81duke nukembard's talemartin korthascii artyoutubepluginpasswordsvideointellivisionngpebaycomicsarticlesc-3000fan gamesmaniac mansionspainsf-7000zaurushomepagex86pc enginerisc ossonicscummcopiersadventure gamedavid foxfellowpc98cpcvaxflyerskigbreplicasgccencyclopediaddjreferenceguideschip8debuggersimcoupemega mansmsusjumpmanartworkgenesis plusindiana jonesapple 1video gamespiratescocoandroidhandyralph baerrom hacksgplik+uae4allcommercialgermansharpunreleasedbbcarchivedpeopleusenetintroductionadammameinterpreterneopocotttcp/ipdosboxoperating systemunderdogsedgegbccompilerpowerpcculturejrpgradiopetpc-88streamingplus/4mz-80copy protectiongradiussegaron gilbertx68000boycott advancecapcompodcastelectronrpggnuboynet yarozesaturncolumnsti-89tnktoshibaosf/1richard bannisterbugsnsflittle johntoshiya takedagamebasewiiquotesinfoneswindowsopen sourcepinoutsnewssega cdmac ossoundsonyepsonbabyarticleshexeni18nfpgagp32game boyhucmp3apple 2gsretrodevneo4allatari 7800atari 5200masterp2000jaguarfm-7mastertronicaixagifeaturehumorcomputerscps2os/2pointless32xeliteenginekonamialtairbiosvic-20newsletterscott adamstechnotesolafnesgamecuberemakemo5excerptti-92pc-6000amstradbenj edwardscommodore65816pdffamtasiaideiasource codegremlintoolscolemtype-ininstallerscastawaycamputers lynxpcwc128francerpgsopenglpcsxconvertersdtvtaitochronologybeebcollectionatari800ssemmz-800neopopincompletewonderswanukmedian64blogdiskmagsscivisual basicgameswikipediacasciiartreviewsauctionsj2medownloadvicecomputingmodsmz-700guideuaegeocitiestoolfirmwarerick dangerousqnxxgsremakeshi-scoresadventure gameswinampstudio 2ti-99/4adatasheetsgp2xpectrumsam coupĂ©softwarecreatorsrottqlvirtual boyapple 2tandyarcadiamike daillylinksms-dosllamasoftflashstella3d realmsarchimedesgallerypublisherzorkvcsmanualspasopiasdksunosbiographyunmaintainedbox shotsunixsg-1000emulatorsfaqsbasicnesgp2xbook3domsxstrategydocsappledarcnesc16vectrexastrocadesmartphonenetworkingwikifreebsdmo6dma design.netdragonfpcemac plusnewsletterstgemunintendojrpgshugues johnsonzx spectrumjavasidcloneshereticconvertermetal gearsymbianapogeewinuaesdlacademicwolfenstein 3dcompatibilitypandoracomputerpsxremixescalculatortriviacollectingplayersclubfusenecboulder dashgizmondopokesmusicmailing listsierrarzxfinal fantasymulewindows cefanzinedoomarstechnicagamasutraitinterviewcompressiontutorialarmcpuonlinecolecovisiontimelinetoolchainsmallmastergearodyssey2messgraphicsibm pcitalymapscartridgethalionlinuxdemozopharabc80tutorialsspectravideoatari stps2sms pluspreservationfaqsolutionsmonkey islandfan artiosatarihardwarespritesamigagame gearpsiontranslationsshmupjeff minterspace invaderswalkthroughscataloggame designfmsxsnes9xzx80screenshotsaction replayvgbversionsneo geohistoryfinal burnmagnetic scrollsnesatomseriesmerchandisemipshead over heelspsfdottmtxz80bo zimmermansharewaretosconsolessupervisionbooksbbc basicbeosacornpentagonassemblerid softwarecd32imagesfan fictionluxorfpsesoundtrackskim-1midiatari stefujitsunamcodownloads65028-bitstorythomsfccasiospecsendingsrom hackingcivilizationlynxgeneratorconversionharvesttrs-80programmingmarat fayzullinx1frodoiflisatrailblazerwalkthroughresourceshintsgiffrontierpocketpcpom1c64dingooscansftpphotosarnoldultimadelphimuseumpaul robsonlucasartsanalysiscommander keenport