emulation

1 2 3 >   Next Page >>
link thumbnail AEP Emulation Page cool ende
Emulation related news and a download database. One of the best sources of emulation updates.
(Added 2006-02-11, 707 hits, more)
link thumbnail LinuxEmu cool
All about emulation on Linux hosts.
[Vanished without a trace between May and July 2014.]
(Added 2003-11-12, 5933 hits, more)
link thumbnail NonMAME hot
NonMAME is the definitive source for all known arcade emulators that either support games that are not in MAME, or provide better emulation of games that are in MAME. This site represents many years of work, collaboration with many people in the emulation community, and countless hours of research. It exists primarily to assist emulator authors in gathering more accurate information on ...
(Added 2003-11-12, 1981 hits, more)
link thumbnail Pete's Domain hot
Home of several excellent (and unmaintained) plugins for PlayStation emulators.
(Added 2003-11-12, 1319 hits, more)
link thumbnail Accuracy takes power: one man's 3GHz quest to build a perfect SNES emulator
An excellent plea for accuracy in software emulation.
(Added 2012-10-08, 705 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 727 hits, more)
link thumbnail Amiga Emulator FAQ
Answers questions regarding Amiga emulation on various host systems, including file transfer and where to obtain target system software.
(Added 2008-07-02, 651 hits, more)
link thumbnail Amiga Forever - Amiga Emulation, Games, History and Support Since 1997
Amiga Forever is the award-winning Amiga emulator, preservation and support package brought to you by Cloanto, Amiga developers since 1986. Different editions of Amiga Forever blend high-quality software and original content with the ultimate set of videos to chronicle and let you experience firsthand the history, culture, challenges and passion behind the Amiga.
(Added 2012-10-08, 372 hits, more)
link thumbnail AmigaSYS enhu
The AmigaSYS is a fully pre-configured AmigaOS system. To install, you'll need the original AmigaOS CD or disk (AmigaOS 3.0 or 3.1 or 3.9), after installing these, we will get the full configured system. The AmigaSYS pack contains every important program, wich could be required by the user.
[...]
AmigaSYS are available on the following platforms: WinUAE (Windows), E-UAE (Am ...
(Added 2007-08-20, 497 hits, more)
link thumbnail Amstrad CPC: Emulation for Beginners enes
An introduction to Amstrad CPC emulation.
(Added 2006-08-11, 578 hits, more)
link thumbnail Back In Time
Site supporting arcade game emulation, as well as all Atari video games and computers.
(Added 2006-09-03, 495 hits, more)
link thumbnail Castlevania Dungeon, The
Forum, features, storyline, characters, arsenal, history, the games, artwork, multimedia, emulation, and fan fiction.
(Added 2003-11-12, 672 hits, more)
link thumbnail Commando Series Online, The
All on Konami's Commando and its sequel, MERCS: Heroes and enemies, weapons and items, multimedia, battlefields, emulation, and web links.
(Added 2007-01-04, 588 hits, more)
link thumbnail CreatiVEmu
creatiVision emulation central. All about VTech's creatiVision.
(Added 2007-06-11, 685 hits, more)
link thumbnail Emu-Celebs
About the people behind emulation and related crafts.
(Added 2006-06-28, 736 hits, more)
1 2 3 >   Next Page >>
Search:

Tags

hugues johnsonschematicsngpralph baerms-dossdlgiana sistersxm6squaresoftwolfenstein 3dcasioacademiczx81infocomx68000fpcegametutorialcalculatorfpsebox shotsstreaminginterpreterflyersretrodevluxorblogpasswordsonlinepublisherwizcartridgeuaemoviesc128sc-3000gamecubefusendswinuaebeosepsonguidefm-7spectravideojrpgzaurusemulationunixstrategyindiana jonesoperating systemspace questbasicnesmsxamstradmagickittoolssam coupĂ©rzxarstechnicafrodocatalogsolarisfinal burnconvertersdoomshmupatomgnuboykegsatari 5200playersvirtual boyc16folklorez-codesymbianbeebcollectionrisc osradiocompilations.netscummcollectingaquariusvic-20commodorebbc basicfrancevcstimelineusmo6commercialsoftwarecharactersresourcesjumpmansoniciosgame designrpgsgame gearedgecreatorscopy protectionjavaculturemega manascii artatari stesoundkigbnecti-89appleatari stbasicpodcastjupiter acemike daillysf-7000sovietguidesopen sourcepcwfm townsmesspalmoswiisms plusrom hacksarchiveti-99/4amultifaceemulator3d realmsjswcompressiondavid foxvbabugsukconverterllamasoftdemo scenewalkthroughinstallersarchivedtriviahucwalkthroughsjrpgsforumrom hackincompleteoriccompetitioncocodescentwscvisual basiciathalionarnoldpinoutspsxvgbfamtasiacompatibilitysharppcsxpc-6000sharewaresgbmastertronictnkfaqspom1richard bannisterhi-scorestoolchainolafnesmaking ofpc-88capcommupenremixesxboxcensorshipnsfadammz-80fan artsciataricopiersdownloadspritesinterpreterslisasoundtracksapogeecolecovisionquasi88arcadiafcegbcc64auctionsdnasfccomicswikiintroductiongraphicsgbamtxatari 7800pc98osf/1commander keenpasopiaflashcartsgeneratorspace invaderssega cdhexendiskmagsremakesarmmanualshistorycompilerfreebsdconsolespsfdelphijum52apple 2mp3electronatari800quotescharles macdonaldvicemac ospreservationfrontiersierrasinclairlinkspetadventure gamesitalypiratesbiosidessemtoswinampduke nukemx86taitoboycott advanceagiflashwikipediareviewsdownloadsprogrammingdma designcomputingkonamirainbowmagnetic scrollsacornencyclopediaspainplus/4xm7sg-1000gccformatsmastergearsnkebayspecslynxgalleryid softwaremaccps2shopgizmondosmartphoneatari 8-bitto8archimedesdtvsimcoupemodsconversionversionsmiditandypsionpc enginedatasheetsnintendoanalysis3doenginefirmwareharvestngcdasciiartaltairhumorpowerpcabc80musicpandorascreenshotsaixnesvaxtrs-80ftpfan fictionfmsxremakengpcgradiuswindowsxzxp2000imagesvideosphilipshereticsegacpcbookmagazinescolumnscheatsstorysidapple 2gsintellivisionmerchandisemetal gearjaguarclubusenetcomputerandroidendingstranslationsneo georon gilbertunreleasedgifpaul robsonj2meartworkto7scummvmtgemufrenchonline playgermanysmsneopopreferencemark3ibmapple 1monkey islandvideohomepagedottgame boyrick dangerousgermanthomsolutionsx1recompileribm pc65816arcadevectrexcd-ifan gamesmanualfpgatoshibasource codedocscaanoo6502featuregp2xpectrumnesterhintsstellapc-98colemfdscsupervisionrom hackingcoverscastawayscott adamsstudio 2toolgp2xjapanneopocottwindows ceadventure gamehitchhikerzorkbabygameszx spectrumbenj edwardscivilizationdosboxreplicasmuleik+faqn64os/2sdkdreamcasthead over heelspv-1000little johnhpsnes9xzopharneo4alltvfanzinemarat fayzullinabandonwarefujitsufellowmaemoscansmuseumtype-initamigabbcmega driveddjhandysunosdingoodebuggerpointlesspsptoshiya takedamipsgenesis plusqlcomputershandheldscorpionbiographygplcartridgessmallmagazinemailing listwonderswaninterviewsjapaneselibrarypdflinuxmasterfinal fantasyiftcp/ipbooksphotosmac plusdumpinggamasutraps2ddrxgsrpgvideo gamesclonesboulder dashdemoschip8mo58-bitodyssey2githubteopokescd32rom listingspeopleastrocadeyoutubepocketpcnvgosxsaturnlucasartsff7qnxmz-700newsletteradsdarcnesjeff minterdragonnewslettersmaniac mansionmamebard's talelost sourcegeocitiesi18nemulatorssnatchergremlinseriespatches32xmapsinterviewtrailblazerplugincodeassemblerrottcp/mdatabasekim-1networkinggrim fandangoaction replayinfoneszx80underdogschronologyultimanamcoportpc-fxtutorialscreativision68kcpuopenglarticleelitecamputers lynxbluemsxunmaintainedromsarticlesexcerptpentagongp32technotesz80composersmarcel de kogelhardwaremartin korthnet yarozemz-800mediauae4allnewsshmupsdemoti-92bo zimmermansonygamebase