beos

1 2 >   Next Page >>
link thumbnail Hu-Go cool enfr
PC Engine emulator derived from FPCE, and available for Linux, Windows, DOS, BeOS, Morphos, and Solaris.
(Added 2003-11-12, 1062 hits, more)
link thumbnail ScummVM cool

ScummVM is a program which allows you to run certain classic graphical point-and-click adventure games, provided you already have their data files. The clever part about this: ScummVM just replaces the executables shipped with the games, allowing you to play them on systems for which they were never designed!

ScummVM supports many adventure games, including LucasArts SCUMM g ...

(Added 2003-11-12, 696 hits, more)
link thumbnail VICE Emulator, The cool
VICE is a program that runs on a Unix, MS-DOS, Win32, OS/2, Acorn RISC OS, BeOS, QNX 4.x, QNX 6.x, Amiga, GP2X, Dingoo, Syllable or Mac OS X machine and executes programs intended for the old 8-bit computers. The current version emulates the C64, the C64DTV, the C128, the VIC20, almost all PET models, the PLUS4 and the CBM-II (aka C610).
(Added 2003-11-12, 745 hits, more)
link thumbnail VisualBoyAdvance cool
(Still?) the best choice for both play and development.
VBA is the best and most popular Gameboy Advance emulator around. Emulates GBA, GBC, SGB, GBA roms! Supports ZIP-ed roms, so that after downloading files from the net you don't even have to un-zip them.
(Added 2003-11-12, 510 hits, more)
link thumbnail asylum.acornarcade.com

SDL Asylum is a C port of the computer game Asylum, which was written by Andy Southgate in 1994 for the Acorn Archimedes and is now public domain. It should be possible to run it on any platform which support SDL and OpenGL graphics. It's developed primarily on Linux but has also been built successfully on Cygwin, FreeBSD, Windows and Haiku.

SDL Asylum is currently li ...

(Added 2007-09-10, 728 hits, more)
link thumbnail BeBeeb
BeOS port of BBC Micro emulator xbeeb. Only the source code has been archived.
(Added 2006-08-17, 455 hits, more)
link thumbnail Beccy
Spectrum emulator for BeOS.
This is just a development preview release of ZX Spectrum Emulator. Development Preview release of Beccy is really resource consuming program. It contain a lot of code which needs optimization. Both Z80 virtual processor code and ZX Spectrum virtual machine may contain some bugs. I would appreciate any informative bug reports.
(Added 2006-08-07, 533 hits, more)
link thumbnail BeebEm for BeOS
BeOS port of BBC BeebEm.
(Added 2006-08-17, 481 hits, more)
link thumbnail BeS9x
BeOS port of Super Famicom emulator Snes9x.
[Source code and a more recent binary can be found at BeEmulated.]
(Added 2006-08-30, 533 hits, more)
link thumbnail BeZX
Sinclair ZX Spectrum emulator for BeOS (x86 and PowerPC), based on XZX.
(Added 2006-08-08, 671 hits, more)
link thumbnail Circus Linux!
A "Circus Atari" clone; despite the name, it is available for numerous platforms and hot on the heels of xrick for the title of "most ported game ever".
(Added 2006-02-10, 669 hits, more)
link thumbnail CloneKeen
Almost complete clone of Commander Keen: Invasion of the Vorticons by ID Games.
In addition to emulating the gameplay of the original Commander Keen games, CloneKeen has some extra features which weren't present in the original game. You can play with 2 people, there is a built-in level editor for creating and sharing your own user maps, and there are some for-fun options such as Full ...
(Added 2006-02-10, 602 hits, more)
link thumbnail Frodo
The free portable C64 emulator. C64 emulator for Linux/Unix, BeOS, and AmigaOS, with ports available for many other platforms.
(Added 2003-11-12, 636 hits, more)
link thumbnail Hatari
Hatari is an Atari ST and STE emulator for GNU/Linux, BSD, BeOS, Mac OS X and other systems that are supported by the SDL library. The Atari ST was a 16/32 bit computer system which was first released by Atari in 1985. Using the Motorola 68000 CPU, it was a very popular computer having quite a lot of CPU power at that time. Unlike many other Atari ST emulators which try to give you a g ...
(Added 2003-11-12, 481 hits, more)
link thumbnail Head over Heels PC
Very good-looking remake for BeOS, Win32, OSX, and Linux.
(Added 2006-02-10, 455 hits, more)
1 2 >   Next Page >>
Search:

Tags

arminfonesreviewsftpvicesmsschematicsplayersgraphicsconversionzx80creativisiontriviaatari800mark3dtvscummvmzx81neopopunmaintainedsc-3000magazinescolumnsgnuboylynxrichard bannisterfrontiernamcogamasutracommercialcapcomseriesstudio 2id softwarekigbgifpalmosatari stdownloadscaanooarcadexboxthalionjrpgenginemaemogp2xguidesjrpgsspainmultifaceultimaintroductionx1cp/mresourcescompressionquasi88smartphonesolariscopiersusralph baerretrodevepsonscanshpformatspaul robsongermanyamstradsidwolfenstein 3dtandyj2meappleuaetrs-80cocowinampdownloaddemo scenesharewarespace questcps2interviewsfdsodyssey2nintendounderdogswindowsuae4allllamasoftsmallmusicdingooimagesgbathomxgsmac plusdottpatchesdreamcastcpcsimcoupeonlinesoundrisc ossfckim-1javadebuggerasciiartwizcopy protectionatari 7800italymediaacademicbo zimmermanzx spectrumdatabaserzxosf/1museuminterpretercompatibilitypspvbacomputermessrom listingsmupenz80making ofwikipediacastawayfujitsurom hackolafnessnkmacatari 8-bitforumtoolchainqnxbeebmodsmerchandisejupiter ace3d realmsinterpretersinstallersscorpionmike daillystrategyaltairarstechnicafanzinehistorymsxmtxadventure gameshardwareps2pcwpowerpcgp32flashjumpmanartworkgame gearmo6tcp/ipti-89saturnadssinclairgame boypodcastadventure gamefamtasiaculturescreenshotspluginvcsatomlost sourcedelphireferenceremakesfrancecompilerarnold32xdocsnewsletterspc-98handheldnetworkingti-99/4aacornastrocadesunosconsolesmarat fayzullinopen sourceidemz-700rainbowcivilizationfreebsdbenj edwardsmo5squaresoftn64ndsphotosmartin korthgeocitiestaitopsxrpgarchimedeshintsti-92zorknvgcomputersdemospublishernespointlessgccdescentcommodoretgemuz-codecomicslibrarygiana sistersgremlinx68000jum52box shotsshopoperating systemfaqsto7xm7magazineadamtnkfm-73dofuseandroidmanualsanalysispandoraaction replaypsflinkscodefeatureclonesemulatorbbc basicnecgizmondodnamega manascii artmoviesfolkloremapspv-1000aquariusmz-800radiocolecovisionjaguaryoutubecollectingvic-20pc-88computingarticledma designcolembloghumorremixesremakec16final fantasyfrodoapple 1maniac mansiondavid foxms-dosmac osatariaixendingsvirtual boyddjbiographymidibugssgbamigadiskmagspdfngpsoftwaretimelinepokesapple 2gscartridgeauctionsexcerptscicatalogversionstype-inkonamitoolsluxorgradiusflyerspentagonboycott advancetutorialgithubnewsmega driveelitepeoplephilipspinoutsspace invadersfm townscharles macdonaldjapangermanvisual basicshmupbookfan artgeneratorbeoscalculatorwalkthroughsfcehomepagenesterconvertercomposersdoomteoelectroninterviewcreatorsstreaminggamebasepc-6000i18nbiosbasiciostrailblazervideomastertronicneo geonewslettercommander keenrottjeff mintercheatsspectravideounreleasedgbc68ksonicibmhi-scoreswsccompilationsduke nukempc98flashcartspetcensorshipzaurussupervisionbard's talengpcstellasdkfinal burnprogrammingclubplus/4sharparticlesvideosfpsecasioapogeeunixtosopenglwikistorycollectioncpuhugues johnsonguideabandonwarearchivetoshiya takedawonderswanconverterssf-7000grim fandangofrenchusenetsource codex86mastercharactersmetal gearddrshmupsagiatari steitik+apple 2fpgamagickitencyclopediacamputers lynxspriteskegsp2000boulder dashmp3mipssnes9xvgbchronologylinuxwindows censflisa.netcoversiafan gamesharvestsega cdfmsxarcadiadatasheetsc64scummsnatcherbluemsxincompletegpldumpingneo4allbooksff7basicnesukedgejapanesemastergearrom hackshead over heelsdosboxgameswinuaepasswordsreplicasmailing listgp2xpectrum65816vaxmanualhexenchip8huclucasartsiforicfan fictionjswsymbianrom hackingatari 5200little johnebayssemtoshibabbctvemulationindiana jonesgame designbabyto8cd-imulepocketpcnet yarozepsionsovietmonkey islandabc80recompilerpom1preservationmarcel de kogelpcsxpc engineqlsonyinfocomfpcedarcnesonline playpiratesgalleryxzxhereticpc-fxcngcdpasopiaosxsms plusfirmwarerpgscartridgesmagnetic scrollsgenesis plusfaqsolutionssam coupĂ©walkthroughassembleribm pcintellivisionsg-1000competitiondemodragonemulatorsvideo gameshandyquotesmz-80gamecubetutorialsmamearchived6502sierraxm6segaromsscott adamssdltoolc128portfellowtechnoteszophartranslationsron gilbertsoundtracksrick dangeroushitchhikerwiicd32neopocott8-bitgamevectrexos/2specs