articles

1 2 3 4 5 6 7 8 >   Next Page >>
link thumbnail Armchair Arcade cool
Dedicated to intelligent coverage and discussion of classic and modern videogame and computer topics. Features commentary on current events, articles, features, games and a plethora of other content.
(Added 2007-01-06, 1107 hits, more)
link thumbnail GameTronik cool fr translate
Great video game archive featuring complete sets for many vintage computer and video game consoles, including some CD-based systems. Fast downloads. Also has gameplay videos, articles, French TV clips, a comic, and more.
(Added 2008-04-15, 1654 hits, more)
link thumbnail Interactive Fiction Archive, The cool
All the interactive fiction-related stuff you can download: Artwork, articles, books, tools, games, interpreters, magazines, programming, solutions, and more.
(Added 2003-11-12, 836 hits, more)
link thumbnail Consolemul hot fr translate
Toute l'émulation console. News, articles, forum, emulators, (PD) ROMs, utilities, and French ROM translations.
(Added 2003-11-12, 1826 hits, more)
link thumbnail Acorn Electron World
Archives of professional and public domain software, magazine cover discs, user group subscription discs, articles, instructions, reviews, screenshots, solutions, and game help.
(Added 2007-09-09, 652 hits, more)
link thumbnail Acorn Elite Pages, The
The Archimedes version of Elite is widely regarded by experts (and myself) as the best installment of the classic game. This site features hints and tips, troubleshooting help, pictures, info on the Thargoids, many, many downloads, magazine articles and interviews, fan fiction, and links to related sites.
(Added 2003-11-12, 600 hits, more)
link thumbnail Acorn Gaming
Welcome to Acorn Gaming. For the 10 years from 1993 to 2003 this site was the longest-running regularly-updated Acorn web magazine in existence. It is now no longer updated.
(Added 2007-09-09, 607 hits, more)
link thumbnail Adventure Classic Gaming
Dedicated to classic and retro adventure gaming. Reviews, exclusive interviews of developers and publishers, features on adventure gaming, and game cheats.
(Added 2006-09-24, 597 hits, more)
link thumbnail Amstrad CPC Hardware page
A few projects for the Amstrad CPC range of computers along with some techie articles out of English CPC mags.
(Added 2008-04-13, 461 hits, more)
link thumbnail Amstrad ESP es translate
almost complete catalog of Spanish games for the CPC, with screenshots and downloads, articles about Spanish software houses, cheats, and a forum; registration required!
(Added 2006-02-24, 1040 hits, more)
link thumbnail Articles on the History of Computing
Numerous articles on the history of computing and software engineering by Michael S. Mahoney, Professor of History at Princeton University.
(Added 2008-06-15, 428 hits, more)
link thumbnail Atari Bin, The
Atari timeline, Lynx and Jaguar FAQs and reviews, many articles.
(Added 2006-08-29, 607 hits, more)
link thumbnail Atari Times, The
Game reviews for all Atari systems, articles, columns, interviews, chat, forums, hi-scores, and more.
(Added 2006-09-14, 599 hits, more)
link thumbnail atari.area pl translate
Atari scene site. News, articles, forum, wiki, interviews, software database.
(Added 2006-09-03, 1162 hits, more)
link thumbnail Black Moon Project, The
We aim to become the premier resource for Philips CD-i related material. Including Reviews, Movies, Articles, Interviews, Boxart, Manual Scans and anything else that could possibly be related to the CD-i.
(Added 2007-01-07, 670 hits, more)
1 2 3 4 5 6 7 8 >   Next Page >>
Search:

Tags

bard's talebabycompressionps2softwareff7scummmastermipsphilipssmallreviewsformatsoricforumhistorysnkhandheldgizmondoascii artsquaresofthucatari stfan fictionauctionsandroid68ksnatcherdingoodumpingmarcel de kogelhead over heelsusenetrom hackslynxx1ngpclinksmultiface8-bitdescenttranslationsintroductiondarcnesgifid softwarearchimedes65816atari steatari 5200wiimz-700vicepokesinterviewcommodorereplicasgithubdragonclubto8kim-1little johnrzxdemosadventure gamesierracatalogmanualrecompilerabc80qlxm6bluemsxspainunixxzxfrontiercolecovisionsms plusremixescps2i18nrom listingsjrpgpodcastiossymbianfolkloregamecubefm townsunreleasedwikinewslettersodyssey2visual basic3d realmsfamtasiaxm7luxorconsolesgp2xpectrumgplfpgahintspom1generatorcomputerwonderswanpatchesassemblerbasicidehumorelitecodemusicjum52resourcesshopgamebasedosboxngpbenj edwardsgp32gradiuspiratesndsplugindtvcollectingstory3dotoolhandygenesis pluscpcmo5screenshotsatari 7800excerptharvestgame boyguideszauruscgermanyindiana jonesmerchandisepaul robsonz80versionsnespv-1000xboxukftpflashcartsnetworkingagimarat fayzullindavid foxmanualscovershpzx81mike daillyteopointlessapogeeshmupvirtual boysoundtrackssaturnms-dososf/1net yarozepspjumpmansolutionsdebuggerdocsdownloadboulder dashfan artpinoutsmamehi-scoresonlineinterpreterssg-1000newsfaqtnkfeatureinstallersdemojrpgs6502pcsxcputrailblazerpc-88hugues johnsonitalyrottiaatari 8-bitgbahomepagefrodocamputers lynxpalmosjswqnxneo4allmagazineatari800collectionmtxmediafdsmega driveconvertersmartphonevic-20gamasutrabbcsonyabandonwareneo geosharewaregiana sistersmastergearsc-3000boycott advanceifpowerpcralph baercartridgesvcszorkpc-fxrom hackyoutubeapple 2gszx80vgbaquariuscp/mkonamimac osgame designfujitsumacsega cdhexenepsonitllamasoftbbc basiccomposersarchivejapaneseapplepentagonmz-80vaxinfonesunderdogsti-89linuxpetcd32ti-99/4addrc128triviainfocomcompatibilitymp3ibm pcfaqscreativisiongeocitiesrick dangerousgbccd-iibmnintendotoshiya takedafellowwsccommercialsgbnewslettercocobookgamesbox shotspocketpcamigabeebartworkcartridgemonkey islandmupenstudio 2sam coupéarstechnicajaguarsdlwizamstradcopiersc64conversionpsfjapanjupiter aceaixvideo gamescaanoopasswordselectron32xfpsemaniac mansionwalkthroughkigbwalkthroughswindows cez-codereferencegp2xpeoplex86charactersgamegermanneopopcommander keenseriesdelphiuae4alladventure gamesinterviewsguidelisabiossfcwinampolafnesedgebasicnesintellivisioncastawayuaegrim fandangoaction replayp2000scummvmmuseumcolumnsadamcompetitionmodsto7solarisarticlemz-800lost sourcedoomcheatsneopocottx68000rom hackingwolfenstein 3dstellabiographytimelinesdkfinal fantasyvbamuleculturecompilergallerytype-incapcomsupervisiondma designfanzinecharles macdonaldscorpionendingspdfsonicfmsxhardwarefinal burnmoviesfreebsdsimcoupescidatabaseretrodevti-92quasi88openglxgsosxcompilationsmailing listmapsarcadenectoolchainsinclairsmsremakessemaltairwinuaepsionnamcoradiogame gearquotesshmupssf-7000c16videosgraphicsjavaportcalculatormagnetic scrollsblogcomputingjeff mintersnes9xpreservationasciiartnesterstreamingthomtutorialconvertersencyclopediaopen sourcepc-6000toshibasource codebugsmagazinescensorshipchronologyplayersspriteszx spectrumpasopiaastrocadepandorabo zimmermanspecssegaprogrammingrainbowvideomark3mo6hitchhikerfan gamesarnoldbeosphotostrs-80libraryspace questcomputersapple 2acornclonesfpce.netik+kegsspace invadershereticpc enginesidmessscansvectrexstrategymetal geartcp/ipcreatorszopharnsfcasioincompletewikipediarichard bannisterapple 1n64franceemulationfrenchmsxatarigremlindownloadsdreamcastemulatorpsxarticlesron gilbertfusediskmagsultimarpgstaitoos/2fceunmaintainedscott adamsrisc osuspc-98copy protectiongcclucasartsflashmega manplus/4demo scenearchiveddnaacademicgnuboymac plusinterpretertossoundarcadiamaking ofnvgadsimagestvemulatorsenginerpgthalionmaemofm-7midiflyersfirmwareddjmartin korthwindowsduke nukemtechnotesngcdanalysispcwsharpremakespublishertutorialsromspc98datasheetstandytoolsonline playsovietschematicsspectravideomastertronicchip8ebaysunosoperating systembooksarmdottj2mecolemcivilizationtgemucomicsmagickitatom